mpidb The Microbial Protein Interaction Database ulijasz-2009-1 Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ulijasz A.T., Falk S.P., Weisblum B. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation ulijasz-2009-2 Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. in vitro In vitro pull down pull down antibody detection identification by antibody antibody detection Ulijasz A.T., Falk S.P., Weisblum B. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation ulijasz-2009-3 Phosphorylation of the RitR DNA-binding domain by a Ser-Thr phosphokinase: implications for global gene regulation in the streptococci. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ulijasz A.T., Falk S.P., Weisblum B. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation a0a0h2unk2_strpn SP_0376 protein protein strpn Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLMLLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKPVLIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREYDLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRGVGYTMQE phpp_strpn Protein phosphatase PhpP phpP PP2C-type phosphatase Ser/Thr phosphoprotein phosphatase protein protein strpn Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) MEISLLTDVGQKRTNNQDYVNHYVNRAGRTMIILADGMGGHRAGNIASEMAVTDLGVAWVDTQIDTVNEVREWFAHYLEIENQKIHQLGQDEAYRGMGTTLEVLAIIDNQAIYAHIGDSRIGLIRGEEYHQLTSDHSLVNELLKAGQLTPEEAEAHPQKNIITQSIGQKDEIQPDFGTVILESGDYLLLDSDGLTNMISGSEIRDIVTSDIPLADKTETLVRFANNAGGLDNITVALVSMNEEDAE b5e778_strp4 SPG_1637 protein protein strain g54 Streptococcus pneumoniae serotype 19F MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVPQALENVIIKATAKKLTNRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLPKVSQSTLTSIPKVQAQTEHKSIKNPSQAVTEETYQPQAPKKHRFKMRYLILLASLVLVAASLIWILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGEEKTEASEKVEEGRIIRTDPGAGTGRKEGTKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIKIEEEESNESEAGTVLKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENLIKIEEEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTKNNLIQIVGIKEANIEVVEVTTAPAGSAEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTSATP The sequence has been withdrawn from uniprot. b5e7b7_strp4 ritR SPG_0342 protein protein strain g54 Streptococcus pneumoniae serotype 19F MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKPVFIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREYDLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRGVGYTMQE The sequence has been withdrawn from uniprot. ritr-phpp 1334762 n/a 1334765 unspecified role unspecified role bait bait not-defined-1567127328 1334766 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2 q97si5-phpp 1334763 n/a 1334765 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dna binding region sufficient to bind sufficient binding region sufficient to bind range range range range false not-defined-1567127328 1334766 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1334778 1334776 physical association physical association false false false Fig. 3 b5e778-ritr-1 1334764 n/a 1334767 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1154028534 1334768 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false Fig. 4