mpidb The Microbial Protein Interaction Database botteaux-2009-1 MxiC is secreted by and controls the substrate specificity of the Shigella flexneri type III secretion apparatus. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Botteaux A., Sory M.P., Biskri L., Parsot C., Allaoui A. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation q6xvw8_shifl Protein-secreting ATPase spa47 protein protein shifl Shigella flexneri MSYIKLLTQLSFPNRISGPILETSLSDVSIGEICNIQAGIESNEIIARAQVVGFHDEKTILSLIGNSRGLSRQTLIKPTAQFLHTQVGRGLLGAVVNPLGEVTDKFAVTDNSEILYRPVDNAPPLYSERAAIEKPFLTGVKVIDSLLTCGEGQRMGIFASAGCGKTFLMNMLIEHSGADIYVIGLIGERGREVTETVDYLKNSEKKSRCVLVYATSDYSSVDRCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAGESPARRGYPVSVFDSLPRLLERPGKLKAGGSITAFYTVLLEDDDFADPLAEEVRSILDGHIYLSRNLAQKGQFPAIDSLKSISRVFTQVVDEKHRIMATAFRELLSEIEELRTIIDFGEYKPGENASQDKIYNKISVVESFLKQDYRLGFTYEQTMELLGETIR mxic_shifl Protein MxiC mxiC CP0146 protein protein shifl Shigella flexneri MLDVKNTGVFSSAFIDRLNAMTNSDDGDETADAELDSGLANSKYIDSSDEMASALSSFINRRDLEKLKGTNSDSQERILDGEEDEINHKIFDLKRTLKDNLPLDRDFIDRLKRYFKDPSDQVLALRELLNEKDLTAEQVELLTKIINEIISGSEKSVNAGINSAIQAKLFGNKMKLEPQLLRACYRGFIMGNISTTDQYIEWLGNFGFNHRHTIVNFVEQSLIVDMDSEKPSCNAYEFGFVLSKLIAIKMIRTSDVIFMKKLESSSLLKDGSLSAEQLLLTLLYIFQYPSESEQILTSVIEVSRASHEDSVVYQTYLSSVNESPHDIFKSESEREIAINILRELVTSAYKKELSR mxic-spa47 1334604 not-defined-174395012 1334605 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false shifl Shigella flexneri not-defined-1909505723 1334606 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 6A mxic-spa47-1 1334604 not-defined-174395012 1334605 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1909505723 1334606 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false Fig. 6C, 6E spa47-mxic 1334604 not-defined-174395012 1334605 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1909505723 1334606 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 6D