mpidb The Microbial Protein Interaction Database frick-2008-2 Identification of a novel protein promoting the colonization and survival of Finegoldia magna, a bacterial commensal and opportunistic pathogen. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Frick I.M., Karlsson C., Morgelin M., Olin A.I., Janjusevic R., Hammarstrom C., Holst E., de Chateau M., Bjorck L. Origin of SPARC/BM-40 was taken from previous work of contributing author (PMID:9233787) Inga-Maria.Frick@med.lu.se Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation frick-2008-3 Identification of a novel protein promoting the colonization and survival of Finegoldia magna, a bacterial commensal and opportunistic pathogen. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Frick I.M., Karlsson C., Morgelin M., Olin A.I., Janjusevic R., Hammarstrom C., Holst E., de Chateau M., Bjorck L. Origin of SPARC/BM-40 was taken from previous work of contributing author (PMID:9233787) Inga-Maria.Frick@med.lu.se Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation frick-2008-1 Identification of a novel protein promoting the colonization and survival of Finegoldia magna, a bacterial commensal and opportunistic pathogen. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Frick I.M., Karlsson C., Morgelin M., Olin A.I., Janjusevic R., Hammarstrom C., Holst E., de Chateau M., Bjorck L. Origin of SPARC/BM-40 was taken from previous work of contributing author (PMID:9233787) Inga-Maria.Frick@med.lu.se Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation q2tv77_finma faf protein protein pepma Peptostreptococcus magnus MKLNKKLLTAALAGALIVTAVPANTFAAEKAPKITENLSEEQAAAKIAELSAEIKTLSERRAEIVAQPWASELTQEGIIEKLQAEETAKKKAYEGAKAAYESATKAWEAAKDAQEKARLAKIEADKKAKAAQGDYYKAIKEAEKERDAAKKAAKEAYDTTIANLQRKFESATAAADKALIELNSAKEALDSAKKSGSNEEQLTRLRKEVEEKELAHETAKNLATRASNERADAKSGAEKALAAAENQADENFQAKKQYLDKKYILSGGWNGSAADLTKLERERLAAIDAYNNAVANTKAAHDAYISARDAFDAASKEYAAATQRTYKITEELKSIEKQLKEKFVTINAILKDQNKGINSLADQLNSELIKELEEFSKLSSSEQFAKIAKLQEELAKLKKEYAKTSEGIQQVKKLVTYQFHVKDTEGKGVQGLTLRLANIDDTSKVYTATSDANGLIQFKSMVEGKYSVTVTKVPTGYDVYQDGKKIDSVKALFRAESEVKAENNAEETKKEETKGNKRVDIPSIIDNTTEGNGEKEEKDNKDEKVIDKATIVVEKKKKDNEDNKDNKKPEKKETKKPAKPAKQRLPKAGAAAEAATIAAAAMATMGGAYISLKKRK sprc_human SPARC ON Basement-membrane protein 40 Osteonectin Secreted protein acidic and rich in cysteine SPARC protein protein human Homo sapiens Human MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI faf-faf 1334200 n/a 1334203 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1334203 unspecified role unspecified role bait bait region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2A sparc-faf-1 1334200 n/a 1334203 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) not-defined-1249196249 1334204 unspecified role unspecified role bait bait region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1334200 Fig. 6 sparc-faf-2 1334201 n/a 1334203 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) not-defined-1249196249 1334204 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 6C sparc-faf-3 1334201 not-defined-1249196249 1334204 unspecified role unspecified role bait bait n/a 1334203 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 6C GST tag used to locate the N-terminus of the molecule, BM40 could then be seen to bind to the C-terminus. sparc-faf 1334202 n/a 1334203 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) not-defined-1249196249 1334204 unspecified role unspecified role bait bait direct interaction direct interaction false false false 1334202 Fig. 6