mpidb The Microbial Protein Interaction Database kim-2008f-1 A possible extended family of regulators of sigma factor activity in Streptomyces coelicolor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim E.S., Song J.Y., Kim D.W., Chater K.F., Lee K.J. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation kim-2008f-2 A possible extended family of regulators of sigma factor activity in Streptomyces coelicolor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim E.S., Song J.Y., Kim D.W., Chater K.F., Lee K.J. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation kim-2008f-3 A possible extended family of regulators of sigma factor activity in Streptomyces coelicolor. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kim E.S., Song J.Y., Kim D.W., Chater K.F., Lee K.J. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation q9l0g5_strco SCO4677 protein protein strco Streptomyces coelicolor A3(2) MNQESTTELTASVRNFSVQLSPTPRGARLARLLATEQLRSWGLPPDPARLLVAELANNAADHGRVPGRDFRLTLYVVGDILRIEVTDTRGQELPAPQKPASDAESGRGLLLVEALAHRWGVTEGRFPRKTVWAELRCTPPEPTF q9rd40_strco SCO0869 protein protein strco Streptomyces coelicolor A3(2) MSVEAEVTVTVVDDVRIVRVAGDYDAVGAETLAHALALPAETGTSGTVVDLAKVTFADSSFLHTLLAAQYRHQTSGIPLVLAEVTPVLQRLLDLTDVTRAFTVAQTVPTATETVHARKSSTRRQ q9ews1_strco Anti-sigma factor antagonist SCO0781 protein protein strco Streptomyces coelicolor A3(2) MSIEHAQTRSIGVTFRADWVVEPPEAGRTGRDRLEARFVRQESASPTRHLRVRHHRGHTVLEFRGEIDIASAAEIAPYLDRETGRPGARVVLDLDGIEFFDCSGLRLLYRARSQVLDGGGQVRLVCTHALTLRMLRITGLARLLPPWPTLDEALGVSRPAGRRTGR rpof_strco RNA polymerase sigma-F factor rpoX 2SCD60.01c SCO4035 sigF protein protein strco Streptomyces coelicolor A3(2) MPASTAPQAPPAPPAQAQAQAPAQAQEAPAPQRSRGADTRALTQVLFGELKGLAPGTPEHDRVRAALIEANLPLVRYAAARFRSRNEPMEDVVQVGTIGLINAIDRFDPERGVQFPTFAMPTVVGEIKRYFRDNVRTVHVPRRLHELWVQVNSATEDLTTAFGRSPTTAEIAERLRITEEEVLSCIEAGRSYHATSLEAAQEGDGLPGLLDRLGYEDPALDGVEHRDLVRHLLVQLPEREQRILLLRYYSNLTQSQISAELGVSQMHVSRLLARSFQRLRSANRIDA q9l0g5-q9rd40-1 1334170 not-defined-830889806 1334173 unspecified role unspecified role bait bait not-defined-1058468144 1334174 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5A q9l0g5-q9ews1-1 1334170 not-defined-816335455 1334175 unspecified role unspecified role prey prey not-defined-341410293 1334173 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5A q9l0g5-sigf 1334170 not-defined-257329223 1334173 unspecified role unspecified role bait bait not-defined-1475637831 1334176 unspecified role unspecified role prey prey physical association physical association false false false Fig 4A sigf-q9l0g5 1334170 not-defined-1201471572 1334173 unspecified role unspecified role prey prey not-defined-2043701510 1334176 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4A q9l0g5-q9ews1 1334171 not-defined-1577988034 1334175 unspecified role unspecified role prey prey not-defined-1478618838 1334173 unspecified role unspecified role bait bait physical association physical association false false false q9l0g5-q9rd40 1334171 not-defined-2133970399 1334174 unspecified role unspecified role prey prey not-defined-92773990 1334173 unspecified role unspecified role bait bait physical association physical association false false false q9l0g5-q9rd40-2 1334172 not-defined-1728502444 1334174 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-900039624 1334173 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 8A