mpidb The Microbial Protein Interaction Database wang-2008h-1 Hierarchal type III secretion of translocators and effectors from Escherichia coli O157:H7 requires the carboxy terminus of SepL that binds to Tir. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang D., Roe A.J., McAteer S., Shipston M.J., Gally D.L. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation wang-2008h-2 Hierarchal type III secretion of translocators and effectors from Escherichia coli O157:H7 requires the carboxy terminus of SepL that binds to Tir. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Wang D., Roe A.J., McAteer S., Shipston M.J., Gally D.L. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation q7db79_eco57 E5F08_27385 sepL ECs_4557 protein protein eco57 Escherichia coli O157:H7 MANGIEFNQNPASVFNSNSLDFELESQQLTQKNSSNISSPLINLQNELAMITSSSLSETIEGLSLGYRKGSARKEEEGSTIEKLLNDMQELLTLTDSDKIKELSLKNSGLLEQHDPTLAMFGNMPKGEIVALISSLLQSKFVKIELKKKYARLLLDLLGEDDWELALLSWLGVGELNQEGIQKIKKLYEKAKDEDSENGASLLDWFMEIKDLPEREKHLKVIIRALSFDLSYMSSFEDKVKTSSIISDLCRVIIFLSLDNYADIISISIKKDKDIILNEVLSIIEHVWLTEDWLLESPSRVSIVEDKHIYYFHLLKDFFTSLPDACFIDSEQRENALLMIGKVIDYKEEII q7db65_eco57 E5F08_27470 sepD ECs_4574 protein protein eco57 Escherichia coli O157:H7 MNNNNGIAKNDCDWLTALDFVKDVNGSPTHLTFYIYQKNAFLHDFGNYWVLYIELSGDFRQVPTDTFIRLCNILAVSNEYKQMGIFLSNKKWYLCQIFHKDNNHRANMSKAIMQHTLASLLDKQFDKLEQLSSSDTMMPPTHLFSDIGRIV tir_eco57 Translocated intimin receptor Tir tir espE Secreted effector protein Tir Z5112 ECs4561 protein protein eco57 Escherichia coli O157:H7 MPIGNLGHNPNVNNSIPPAPPLPSQTDGAGGRGQLINSTGPLGSRALFTPVRNSMADSGDNRASDVPGLPVNPMRLAASEITLNDGFEVLHDHGPLDTLNRQIGSSVFRVETQEDGKHIAVGQRNGVETSVVLSDQEYARLQSIDPEGKDKFVFTGGRGGAGHAMVTVASDITEARQRILELLEPKGTGESKGAGESKGVGELRESNSGAENTTETQTSTSTSSLRSDPKLWLALGTVATGLIGLAATGIVQALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAGYGLSGALILGGGIGVAVTAALHRKNQPVEQTTTTTTTTTTTSARTVENKPANNTPAQGNVDTPGSEDTMESRRSSMASTSSTFFDTSSIGTVQNPYADVKTSLHDSQVPTSNSNTSVQNMGNTDSVVYSTIQHPPRDTTDNGARLLGNPSAGIQSTYARLALSGGLRHDMGGLTGGSNSAVNTSNNPPAPGSHRFV cest_eco57 Tir chaperone L0026 ECs4560 Z5111 cesT protein protein eco57 Escherichia coli O157:H7 MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISSSDNKHYYAGR q7db65-sepl-2 1333877 not-defined-298790746 1333879 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1690024754 1333880 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3 tir-sepl 1333877 n/a 1333881 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) not-defined-1054527471 1333879 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 5B sepl-tir-2 1333877 n/a 1333881 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) not-defined-1054527471 1333879 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 5B sepl-tir-3 1333877 n/a 1333881 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) not-defined-1054527471 1333879 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 6 cest-tir-2 1333877 n/a 1333881 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-751200319 1333882 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 5B cest-tir-1 1333878 n/a 1333881 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-751200319 1333882 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 5B sepl-tir-1 1333878 n/a 1333881 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1054527471 1333879 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 5B