UniProt UniProt http://www.uniprot.org fjorback-2009-1 Membrane glycoprotein M6B interacts with the human serotonin transporter. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation fjorback-2009-2 Membrane glycoprotein M6B interacts with the human serotonin transporter. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation fjorback-2009-3 Membrane glycoprotein M6B interacts with the human serotonin transporter. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation fjorback-2009-4 Membrane glycoprotein M6B interacts with the human serotonin transporter. rat-rn46a Rattus norvegicus RN46A cell line rn46a RN46A temperature-sensitive neuronal cell line derived from E13 rat raphe nucleus confocal microscopy confocal microscopy immunostaining immunostaining Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation fjorback-2009-5 Membrane glycoprotein M6B interacts with the human serotonin transporter. human-msr-293 Homo sapiens msr-293 HEK-MSR-293 cell line expressing the human macrophage scavenger receptor confocal microscopy confocal microscopy immunostaining immunostaining Fjorback A.W., Muller H.K., Wiborg O. Origin of c-myc-M6B used in pull down fig 1B according pmid 11749036 ('...gift from Dr Werner...') owiborg@post.tele.dk human brain cDNA J. Mol. Neurosci. (0895-8696) 2009 Only protein-protein interactions imex curation gpm6b_human Neuronal membrane glycoprotein M6-b GPM6B M6B protein protein human Homo sapiens Human MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALLIYMMATTYNYAVLKFKSREDCCTKF sc6a4_human Sodium-dependent serotonin transporter SLC6A4 HTT SERT 5HT transporter Solute carrier family 6 member 4 protein protein human Homo sapiens Human METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV gpm6b_mouse Neuronal membrane glycoprotein M6-b Gpm6b M6b protein protein mouse Mus musculus Mouse MKPAMETAAEENTEQSQERKVNSRAEMEIGRYHWMYPGSKNHQYRPVPNLGDRAGPLSSPGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNTSDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQSNGTSGVEQICVDVRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALIHFLMILSSNWAYLKDASKMQAYQDIKAKEEQELQDIQSRSKEQLNSYT sc6a4_rat Sodium-dependent serotonin transporter Slc6a4 5HT transporter Solute carrier family 6 member 4 protein protein rat Rattus norvegicus (Rat) Rat METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEASHSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIIAWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIHQSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGATLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLTLTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLISTPGTLKERIIKSITPETPTEIPCGDIRMNAV gpm6b_rat Neuronal membrane glycoprotein M6-b Gpm6b rhombex-29 M6b Rhombencephalic expression protein-29 kDa protein protein rat Rattus norvegicus (Rat) Rat MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNTSDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQSNGTSGVEQICVDVRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALLIYMMATTYNYAVLKFKSREDCCPKF slc6a4-gpm6b 1290404 n/a 1290409 unspecified role unspecified role prey prey n/a 1290410 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure slc6a4-gpm6b-2 1290405 n/a 1290411 unspecified role unspecified role prey prey cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-msr-293 Homo sapiens msr-293 HEK-MSR-293 cell line expressing the human macrophage scavenger receptor n/a 1290410 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1b slc6a4-gpm6b-1 1290406 n/a 1290412 unspecified role unspecified role bait bait n/a 1290413 unspecified role unspecified role prey prey physical association physical association false false false 1c gpm6b-slc6a4 1290407 n/a 1290412 unspecified role unspecified role neutral component neutral component n/a 1290413 unspecified role unspecified role neutral component neutral component association association false false false 6D gpm6b-slc6a4-1 1290408 n/a 1290410 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n/a 1290411 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6a