MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lin-2008c-1 Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. rat-renal cortex Rattus norvegicus kidney-renal_cortex renal cortex anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation lin-2008c-2 Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. rat-outer medulla Rattus norvegicus kidney-outer_medulla kidney outer medulla anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation lin-2008c-3 Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation lin-2008c-4 Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels. rat-renal cortex Rattus norvegicus kidney-renal_cortex renal cortex fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lin D., Kamsteeg EJ., Zhang Y., Jin Y., Sterling H., Yue P., Roos M., Duffield A., Spencer J., Caplan M., Wang WH. J. Biol. Chem. (0021-9258) 2008 partial coverage rapid curation ptpra_rat Receptor-type tyrosine-protein phosphatase alpha Ptpra Lrp protein protein rat Rattus norvegicus (Rat) Rat MDSWFILILFGSGLIHISANNTTTVSPSLGTTRLIKTSTTESAKEENKTSNSTSSVISLSVTPTFSPNLTLEPTYVTTVNSSHSDNGTKRAASTESGGTTISPNGTYGTWLTDNQFTDARTEPWEGNSSSAATTPETFPPADETPIIAVMVALSSLLVILFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNLLPYDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWPYGNVRVSVEDVTVLVDYTVRKFCIQQVGDVTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHSERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLDTHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGYLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDPYRQKDSYIASQGPLLHTTEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMINIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLECVKAEGILDVFQTVKTLRLQRPHMVQILEQYEFCYKVVQEYIDAFSDYANFK mint cd63_rat CD63 antigen Cd63 Mast cell antigen AD1 protein protein rat Rattus norvegicus (Rat) Rat MAVEGGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNYLTDNKTATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSIRSGYEVM mint homomint May be involved in the secretory process of mast cells and may play some role in signal transduction pathways src_rat Proto-oncogene tyrosine-protein kinase Src Src pp60c-src Proto-oncogene c-Src protein protein rat Rattus norvegicus (Rat) Rat MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFVPPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL mint homomint cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL ptpra-cd63 1269378 ptpra_rat RPTP alfa 1269382 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cd63_rat CD63 1269383 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2A mint cd63-ptpra 1269378 ptpra_rat RPTP alfa 1269382 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cd63_rat CD63 1269383 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2B mint ptpra-src-5 1269378 ptpra_rat RPTP alfa 1269382 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level src_rat cSrc 1269384 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F4C mint cd63-src-1 1269378 cd63_rat CD63 1269383 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level src_rat cSrc 1269384 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F4D homomint mint ptpra-cd63-1 1269379 ptpra_rat RPTP alfa 1269382 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cd63_rat CD63 1269383 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2A mint cd63-ptpra-1 1269379 cd63_rat CD63 1269383 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ptpra_rat RPTP alfa 1269382 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2B mint cd63-src-2 1269379 cd63_rat CD63 1269383 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level src_rat cSrc 1269384 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F4D homomint mint ptpra-cd63-2 1269380 ptpra_rat RPTP alfa 1269382 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cd63_human CD63 1269385 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false F2C mint ptpra-src-4 1269380 ptpra_rat RPTP alfa 1269382 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level src_human cSrc 1269386 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false F4A mint cd63-src 1269380 src_human cSrc 1269386 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell cd63_human CD63 1269385 antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F4B homomint mint cd63-ptpra-2 1269381 ptpra_rat RPTP alfa 1269382 antibody detection identification by antibody antibody detection unspecified role unspecified role unspecified role unspecified role living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cd63_rat CD63 1269383 antibody detection identification by antibody antibody detection unspecified role unspecified role unspecified role unspecified role living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false F1 mint