mpidb The Microbial Protein Interaction Database rangarajan-2008-1 Structure of [NiFe] hydrogenase maturation protein HypE from Escherichia coli and its interaction with HypF. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rangarajan E.S., Asinas A., Proteau A., Munger C., Baardsnes J., Iannuzzi P., Matte A., Cygler M. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation rangarajan-2008-2 Structure of [NiFe] hydrogenase maturation protein HypE from Escherichia coli and its interaction with HypF. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Rangarajan E.S., Asinas A., Proteau A., Munger C., Baardsnes J., Iannuzzi P., Matte A., Cygler M. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation rangarajan-2008-3 Structure of [NiFe] hydrogenase maturation protein HypE from Escherichia coli and its interaction with HypF. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Rangarajan E.S., Asinas A., Proteau A., Munger C., Baardsnes J., Iannuzzi P., Matte A., Cygler M. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation q8x849_eco57 Carbamoyltransferase HypF hypF Z4020 protein protein eco57 Escherichia coli O157:H7 MAKNTSCGVQLRIRGKVQGVGFRPFVWQLAQQLNLHGDVCNDGDGVEVRLLEDPETFLVQLHQHCPPLARIDSVEREPFIWSQLPTEFTIRQSAGGAMNTQIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVQQQNWXVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGEVQNG q8x814_eco57 hypE Z4039 protein protein eco57 Escherichia coli O157:H7 MQQLINSLFMEAFANPWLAEQEDQARLDLAQLVAEGDRLAFSTDSYVIDPLFFPGGNIGKLAICGTANDVAVSGAIPRYLSCGFILEEGLPMETLKAVVTSMAETARTAGIAIVTGDTKVVQRGAADKLFINTAGMGAIPTNIHWGAQTLTAGDILLVSGTLGDHGATILNLREQLGLDGELVSDCAVLTPLIQTLRDIPGVKALRDATRGGVNAVVHEXAAACGCGIEISESALPVKPAVRGVCELLGLDALNFANEGKLVIAVERNAAEQVLAALHSHPLGKDAALIGEVVERKGVRLAGLYGVKRTLDLPHAEPLPRIC hype-hypf-1 1332428 not-defined-1101496838 1332431 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 not-defined-320681236 1332432 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false Fig. 3 hype-hype-1 1332428 not-defined-1117483770 1332432 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 not-defined-694459144 1332432 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1332445 1332441 physical association physical association false false false Fig. 3 hype-hypf-1 1332429 not-defined-179096157 1332432 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli not-defined-1424525057 1332431 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false Fig. 3C hype-hypf-1 1332430 not-defined-1424525057 1332431 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli not-defined-179096157 1332432 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false 1332430 Fig. 4