mpidb The Microbial Protein Interaction Database wicker_planquart-2008-1 Interactions of an essential Bacillus subtilis GTPase, YsxC, with ribosomes. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Wicker-Planquart C., Foucher A.E., Louwagie M., Britton R.A., Jault J.M. catherine.wicker-planquart@ibs.fr J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation wicker_planquart-2008-2 Interactions of an essential Bacillus subtilis GTPase, YsxC, with ribosomes. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wicker-Planquart C., Foucher A.E., Louwagie M., Britton R.A., Jault J.M. catherine.wicker-planquart@ibs.fr J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation engb_bacsu Probable GTP-binding protein EngB engB ysxC BSU28190 protein protein bacsu Bacillus subtilis MKVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMINR rl1_bacsu 50S ribosomal protein L1 rplA BSU01030 protein protein bacsu Bacillus subtilis MAKKGKKYVEAAKLVDRSKAYDVSEAVALVKKTNTAKFDATVEVAFRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDTDYINKIQQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEYRVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGVKVDSSTFNVK rl3_bacsu 50S ribosomal protein L3 rplC BSU01160 protein protein bacsu Bacillus subtilis MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDGYEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGRMGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK rl10_bacsu 50S ribosomal protein L10 BL5 Cold acclimatization protein Vegetative protein 300 BSU01040 rplJ protein protein bacsu Bacillus subtilis MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHEALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALAAKAVAEQKEEQGA rl6_bacsu 50S ribosomal protein L6 BL10 BSU01310 rplF protein protein bacsu Bacillus subtilis MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRRKEGKSAK rl23_bacsu 50S ribosomal protein L23 rplW BSU01180 protein protein bacsu Bacillus subtilis MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA rl27_bacsu 50S ribosomal protein L27 BL24 BL30 BSU27940 rpmA protein protein bacsu Bacillus subtilis MLRLDLQFFASKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFAKIDGTVKFERFGRDRKKVSVYPVAQ rl7_bacsu 50S ribosomal protein L7/L12 BL9 Vegetative protein 341 BSU01050 rplL protein protein bacsu Bacillus subtilis MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGAAAGGAAEEQSEFDLILAGAGSQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGASVEVK engb-rpla-2 1332258 not-defined-681773710 1332260 unspecified role unspecified role bait bait ecolx Escherichia coli not-defined-1213185118 1332261 unspecified role unspecified role prey prey bacsu Bacillus subtilis n/a 1332262 unspecified role unspecified role prey prey bacsu Bacillus subtilis physical association physical association false false false Table 1 engb-rpla-3 1332258 not-defined-252572603 1332262 unspecified role unspecified role prey prey bacsu Bacillus subtilis not-defined-481625701 1332260 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1332261 unspecified role unspecified role prey prey bacsu Bacillus subtilis physical association physical association false false false Table 1 engb-rplf-1 1332258 not-defined-1199249777 1332263 unspecified role unspecified role prey prey bacsu Bacillus subtilis not-defined-1145899273 1332260 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1332264 unspecified role unspecified role prey prey bacsu Bacillus subtilis physical association physical association false false false Table 1 engb-rpll-1 1332258 n/a 1332265 unspecified role unspecified role prey prey bacsu Bacillus subtilis n/a 1332266 unspecified role unspecified role prey prey bacsu Bacillus subtilis not-defined-586222605 1332267 unspecified role unspecified role prey prey bacsu Bacillus subtilis not-defined-523708453 1332260 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Table 1 engb-rplf-2 1332259 n/a 1332264 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-232797417 1332260 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 7 engb-rpll-2 1332259 not-defined-1347982636 1332260 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1332267 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 7 engb-rpla-1 1332259 not-defined-1387993452 1332260 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-227705140 1332261 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 7