mpidb The Microbial Protein Interaction Database de_la_mora-2007-1 The flagellar muramidase from the photosynthetic bacterium Rhodobacter sphaeroides. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot de la Mora J., Ballado T., González-Pedrajo B., Camarena L., Dreyfus G. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation de_la_mora-2007-2 The flagellar muramidase from the photosynthetic bacterium Rhodobacter sphaeroides. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot de la Mora J., Ballado T., González-Pedrajo B., Camarena L., Dreyfus G. J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation f5m064_rhosh RSWS8N_05590 protein protein rhodobacter sphaeroides ws8n Rhodobacter sphaeroides WS8N MELKLQALTPLSLSGSRAQPAGREDLRQAAEGFESLFLTQLLKAGRAGLPGGDLLGSSGVDTARDMLDMELAKSSAGRAGLGIADAIERQFAPLVRDGKS The sequence has been withdrawn from uniprot. f5m061_rhosh RSWS8N_05575 protein protein rhodobacter sphaeroides ws8n Rhodobacter sphaeroides WS8N MRFALVLILTLLAAPALAADEGCETLAARAGAEAGIPEGLMEAIARVESGRGGRAWPWTLNQGGRGMFFETRAEAVRMLQATVASGVSNIDVGCMQLNWRWHAPAFASADEMIDPVRNTRHAARFLRELRARLGSWEAATAAYHSADRGRGAAYLAKVEAERGGSRLAEAATDLPDEATLAAARVQGILVLAPQPMVSLGETQGGLPRAASDIPSQGPLELRAAAPDLLAEADLPQRLRARFHAVQSFRDLLAMQP The sequence has been withdrawn from uniprot. f5m061-f5m064 1332132 n/a 1332134 unspecified role unspecified role prey prey n/a 1332135 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5A f5m061-f5m064-1 1332133 n/a 1332134 unspecified role unspecified role prey prey n/a 1332135 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5B