IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cipolat-2006-2 Mitochondrial rhomboid PARL regulates cytochrome c release during apoptosis via OPA1-dependent cristae remodeling. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cipolat S., Rudka T., Hartmann D., Costa V., Serneels L., Craessaerts K., Metzger K., Frezza C., Annaert W., D'Adamio L., Derks C., Dejaegere T., Pellegrini L., D'Hooge R., Scorrano L., De Strooper B. The coinmunoprecipitation was performed using mitochondria purified from mouse liver. PARL-OPA1 interaction as detected by yeast two-hybrid was not curated because the species of the constructs could not be ascertained. luca.scorrano@unipd.it; bart.destrooper@med.kuleuven.be E-mail adresses from both authors fail when attemps to contact them were made. Cell (0092-8674) 2006 Only protein-protein interactions imex curation cipolat-2006-1 Mitochondrial rhomboid PARL regulates cytochrome c release during apoptosis via OPA1-dependent cristae remodeling. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cipolat S., Rudka T., Hartmann D., Costa V., Serneels L., Craessaerts K., Metzger K., Frezza C., Annaert W., D'Adamio L., Derks C., Dejaegere T., Pellegrini L., D'Hooge R., Scorrano L., De Strooper B. The coinmunoprecipitation was performed using mitochondria purified from mouse liver. PARL-OPA1 interaction as detected by yeast two-hybrid was not curated because the species of the constructs could not be ascertained. luca.scorrano@unipd.it; bart.destrooper@med.kuleuven.be E-mail adresses from both authors fail when attemps to contact them were made. Cell (0092-8674) 2006 Only protein-protein interactions imex curation bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ bax_mouse Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG opa1_mouse Dynamin-like 120 kDa protein, mitochondrial Optic atrophy protein 1 homolog Large GTP-binding protein Opa1 protein protein mouse Mus musculus Mouse MWRAGRAAVACEVCQSLVKHSSGIQRNVPLQKLHLVSRSIYRSHHPALKLQRPQLRTPFQQFSSLTHLSLHKLKLSPIKYGYQPRRNFWPARLAARLLKLRYIILGSAVGGGYTAKKTFDEWKDMIPDLSDYKWIVPDFIWEIDEYIDLEKIRKALPSSEDLASLAPDLDKITESLSLLKDFFTAGSPGETAFRATDHGSESDKHYRKVSDKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQGRLKDTENAIENMIGPDWKKRWMYWKNRTQEQCVHNETKNELEKMLKVNDEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCNLCRRGFYYYQRHFIDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKVKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK parl_mouse Presenilins-associated rhomboid-like protein, mitochondrial Parl Psarl Mitochondrial intramembrane-cleaving protease PARL protein protein mouse Mus musculus Mouse MALQGWVQRGWRCGPAWAPPLGGGYRELSATQAPRLLGRRFNLFVQQKCGFRKAPRKVEPRRSDTGSSGEAYKRSALIPPLEETVFYPSPYPIRTLVKPFFFTIGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGNLRKEINKWWNSLSDGQRTVTGIIAANALVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFVAVYLSAGVISNFVSYVCKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPVFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYITYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK bcl2-bad-3 1267413 n/a 1267415 unspecified role unspecified role bait bait bcl2 minus transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1267416 unspecified role unspecified role prey prey physical association physical association false false false table S1 bcl2-bax-4 1267413 n/a 1267415 unspecified role unspecified role bait bait bcl2 minus transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1267417 unspecified role unspecified role prey prey bax minus transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false table S1 parl-opa1 1267414 n/a 1267418 unspecified role unspecified role prey prey n/a 1267419 unspecified role unspecified role bait bait physical association physical association false false false 7b