mbinfo MBInfo http://www.mechanobio.info/ http://www.mechanobio.info/ sirotkin-2005-3 Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu J. Cell Biol. (0021-9525) 2005 Only protein-protein interactions imex curation sirotkin-2005-2 Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu J. Cell Biol. (0021-9525) 2005 Only protein-protein interactions imex curation sirotkin-2005-1 Interactions of WASp, myosin-I, and verprolin with Arp2/3 complex during actin patch assembly in fission yeast. schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Sirotkin V., Beltzner C.C., Marchand J.B., Pollard T.D. The interaction between verprolin and G-actin in Fig 2D could not be curated since the organism source and the specific isoform of actin used was not identified. Arp2/3 complex isolated by affinity chromatography was further purified by ion exchange chromatography. The components were detected by coomassie staining and the identity of a subset of components was further confirmed by mass spectrometry. The source of the Arp2/3 complex components and of N-WASP specified by the author. thomas.pollard@yale.edu J. Cell Biol. (0021-9525) 2005 Only protein-protein interactions imex curation myo1_schpo Myosin-1 myo1 SPBC146.13c Class I unconventional myosin Type I myosin protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAILKRTNRAKAATAAAPNSTGKSNGIKKAVYTSTRKKTVGVDDLTLLSKITDEEINKNLELRFRNGEIYTYIGHVLISVNPFRDLGIYTMDILKSYQGKNRLETSPHVYAIAENAYYQMKSYHENQCIIISGESGAGKTEAAKRIMQYITHVSKSVGTEIERVSEIILATNPLLESFGCAKTLRNNNSSRHGKYLEMIFNSGGVPVGAKITNYLLEKNRIVNQVRNERNFHIFYQFTKSAPQKYRDTYGIQGPENYVYTSACQCLSVDGISDEKDFQGTMNAMKVIGITEPEQDEIFRMLSIILWLGNIQFQEGQDGGSVISDKSITEFLGYLIGVPVAAIERALTIRIMQTQHGARRGSVYEVPLNPTQALAVRDALSMAIYNCLFDWIVERVNKALVTSDNSVSNSIGILDIYGFEIFENNSFEQLCINYVNEKLQQIFIELTLKTEQEEYVREQIAWTPIKYFNNKVVCDLIESKRPPGLFAAMNDAIATAHADSAAADSAFAQRLNFLSSNPHFEQRQNQFIVKHYAGDVTYSITGMTDKNKDQLATDILNLIHSSNNEFMKSIFPVAEESNSRRRPPTAGDRIKTSANDLVETLMKCQPSYIRTIKPNQTKSPNDYDQQMVLHQIKYLGLQENIRIRRAGFAYRQAFDTFAQRFAVLSGKTSYAGEYTWQGDDKSACEQILKDTNIPSSEYQMGTSKVFIKNPETLFALEDMRDKFWDTMATRIQRAWRSYVRRRSEAAACIQKLWNRNKVNMELERVRNEGTKLLQGKKQRRRYSILGSRKFYGDYLSASKPNGTLWNTCGLSQNDHVIFSMRCEVLVHKLGRTSKPSPRQLVLTKKNLYLVITKIVDQKLTQQVEKKFAVSSIDSVGLTNLQDDWVAIRNKSSQNGDMFLRCFFKTEFITTLKRINRNIQVIVGPTIQYCRKPGKVQTVKTAKDETTKDYDYYKSGTIHVGTGLPPTSKSKPFPRLATGGSTAAARGPRPVVQNKPAATKPVSMPAAKSKPAPMANPVSTAQQTQNRPPAPAMQARPNTTQAAAPVTSTTTTIKQATTVSASKPAPSTVTSAASSPSNISKPSAPVANNVSKPSAVPPPPPPPPAEVEKKDLYLALYDFAGRSPNEMTIKKDEIIEIVQKEPSGWWLALKNGAEGWVPATYVTEYKGSTPQTTASSTNVAAQANNNASPAEVNNLAGSLADALRMRASAVRGSDEEEDW wsp1_schpo Wiskott-Aldrich syndrome protein homolog 1 wsp1 SPAC4F10.15c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPPSSSITQEDKATIRKYIPKSTNKIIAAAVVKLYVAYPDPNKWNYTGLCGALVLSYDTTAKCCWFKLVDVVNNSGIIWDQELYQNMDYRQDRTFFHSFELDKCLAGFSFANETDAQKFYKKVLDKGCHPESIENPVLSFITRKGSSRHAPNNSNIQPPSAAPPVPGKENYNAVGSKSPNEPELLNSLDPSLIDSLMKMGISQDQIAENADFVKAYLNESAGTPTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAPVASIAELPQQDGRANLMASIRASGGMDLLKSRKVSASPSVASTKTSNPPVEAPPSNNLMDALASALNQRKTKVAQSDEEDEDDDEWD vrp1_schpo Verprolin SPBC13E7.09 vrp1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAPAPPPPPPAPAPAAAAPAPPLMTGDRSALLNSIQKGKKLKKATTNDRSAPVVGGGVVGERKSNTPKSFAAPPVPTGAPSLPTSSNNTQQAEERPSMPALGGLFAGGMPKLRHIGKSSASAAPPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPNRGPSIPSASVPPVPPSSYVLQQRPNRVDDHGRFHFKDDSYLPIPHPFLGVPKVYRGGSGTTVPLNLSSF arpc5_schpo Actin-related protein 2/3 complex subunit 5 SPAC17G8.04c Arp2/3 complex 16 kDa subunit arc5 arc16 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTFRTLDVDSITEPVLTEQDIFPIRNETAEQVQAAVSQLIPQARSAIQTGNALQGLKTLLSYVPYGNDVQEVRTQYLNAFVDVLSNIRAADIPAFVKECSTEEIDNIVNFIYRGLANPQAYNSSVLLNWHEKVVEISGIGCIVRVLNSRPDL arp2_schpo Actin-related protein 2 Actin-like protein 2 arp2 SPAC11H11.06 SPAC22F8.01 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEAVRSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREKMCETMFERYGFGGVYVAIQAVLSLYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLVGRLDVAGRDATRYLISLLLRKGYAFNRTADFETVREMKEKLCYVSYDLELDHKLSEETTVLMRNYTLPDGRVIKVGSERYECPECLFQPHLVGSEQPGLSEFIFDTIQAADVDIRKYLYRAIVLSGGSSMYAGLPSRLEKEIKQLWFERVLHGDPARLPNFKVKIEDAPRRRHAVFIGGAVLADIMAQNDHMWVSKAEWEEYGVRALDKLGPRTT arpc4_schpo Actin-related protein 2/3 complex subunit 4 arc4 SPAC6G9.07c Arp2/3 complex 20 kDa arp20 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNTLRPYLNAVRSTLTASLALEEFSSEIVERQSQPEVEVGRSPEILLKPLVVSRNEQEQCLIESSVNSVRFSIRIKQVDEIERILVRKFMQFLMGRAESFFILRRKPVQGYDISFLITNYHTEEMLKHKLVDFIIEFMEEVDAEISEMKLFLNGRARLVAETYLSCF arpc2_schpo Actin-related protein 2/3 complex subunit 2 SPAC6F6.10c Arp2/3 complex 34 kDa subunit arc2 arc34 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLSLDYNNIFIYELLTERFSSENPSSIDQVVTDFDGVTFHISTPEEKTKILISLSMKCYPELVNYGTLDLLKQIYGAYVHEPEMGYNFSILIDLQQLPATDEEKEQLAMSISMLKRNVLAAPFHRAFTKQAELADLARKDPENAPMLDKQATSQELMAIHYRDEETIVLWPEHDRVTVVFSTKFREETDRIFGKVFLQEFVDARRRPAIQTAPQVLFSYRDPPLEIRDIQGIQKGDDFGFVTFVLFERHFTPQNREDCISHIQVFRNTLHFHIKASKAYMHQRMRKRVADFQKVLNRAKPDVELERKTATGRSFVRA arp3_schpo Actin-related protein 3 act2 SPAC630.03 Actin-like protein 3 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASFNVPIIMDNGTGYSKLGYAGNDAPSYVFPTVIATRSAGASSGPAVSSKPSYMASKGSGHLSSKRATEDLDFFIGNDALKKASAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVVDSGDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTYFVQSLLRDRNEPDSSLKTAERIKEECCYVCPDIVKEFSRFDREPDRYLKYASESITGHSTTIDVGFERFLAPEIFFNPEIASSDFLTPLPELVDNVVQSSPIDVRKGLYKNIVLSGGSTLFKNFGNRLQRDLKRIVDERIHRSEMLSGAKSGGVDVNVISHKRQRNAVWFGGSLLAQTPEFGSYCHTKADYEEYGASIARRYQIFGNSL arpc1_schpo Actin-related protein 2/3 complex subunit 1 arc1 SPBC14C8.06 Arp2/3 complex 41 kDa subunit p41-ARC sop2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MATSQVLHILPKPSYEHAFNSQRTEFVTTTATNQVELYEQDGNGWKHARTFSDHDKIVTCVDWAPKSNRIVTCSQDRNAYVYEKRPDGTWKQTLVLLRLNRAATFVRWSPNEDKFAVGSGARVISVCYFEQENDWWVSKHLKRPLRSTILSLDWHPNNVLLAAGCADRKAYVLSAYVRDVDAKPEASVWGSRLPFNTVCAEYPSGGWVHAVGFSPSGNALAYAGHDSSVTIAYPSAPEQPPRALITVKLSQLPLRSLLWANESAIVAAGYNYSPILLQGNESGWAHTRDLDAGTSKTSFTHTGNTGEGREEEGPVSFTALRSTFRNMDLKGSSQSISSLPTVHQNMIATLRPYAGTPGNITAFTSSGTDGRVVLWTL arpc3_schpo Actin-related protein 2/3 complex subunit 3 SPBC1778.08c Arp2/3 complex 21 kDa subunit arc3 arc21 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPAYHSSFLSLTDVPTTGNIAMLPLKTKFRGPAYPADESQMDIIDECIGLFRANCFFRNFEIKGPADRTLIYGTLFISECLGRVNGLNYRDAERQLNSLALENFSIPGSAGFPLNALYAPPLSPQDAEIMRTYLTQFRQELAYRLLSHVYATEKDHPSKWWTCFSKRRFMNKAL myo1-wsp1-4 1309064 n/a 1309067 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309068 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 5A, Suppl. Table 2. vrp1-wsp1-3 1309064 n/a 1309069 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309068 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 5B, Suppl. Table 2. arc5-wsp1 1309064 n/a 1309068 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309070 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 5D, Suppl. Table 2. arc5-myo1 1309064 n/a 1309067 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309070 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 5C, Suppl. Table 2. arc5-myo1-1 1309064 n/a 1309067 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309070 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Suppl. Table 2. arc5-wsp1-1 1309064 n/a 1309068 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309070 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Suppl. Table 2. arc5-vrp1 1309064 n/a 1309069 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309070 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Suppl. Table 2. myo1-wsp1-6 1309064 n/a 1309067 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309068 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Suppl. Table 2. myo1-vrp1-3 1309064 n/a 1309067 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1309069 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Suppl. Table 2. act2-arc1-1 1309065 n/a 1309067 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false acidic domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false The sequence range of the acidic domain was taken from previous references of the contributing author [PMID: 11076964]. ecoli Escherichia coli (strain K12) n/a 1309071 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309070 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309072 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309073 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309074 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309075 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309076 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast association association false false false 1309065 Fig 2A. act2-arc1-2 1309065 n/a 1309068 unspecified role unspecified role bait bait vca region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1309076 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309071 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309074 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309075 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309073 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309070 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast n/a 1309072 unspecified role unspecified role prey prey schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast association association false false false 1309065 Fig 2B. myo1-vrp1 1309065 n/a 1309067 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false The sequence range of the SH3 domain taken from previous references of the contributing author [PMID:11076964]. ecoli Escherichia coli (strain K12) n/a 1309069 unspecified role unspecified role prey prey c-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1309065 Fig 2C, Table 1. act2-arc1 1309066 n/a 1309076 unspecified role unspecified role unspecified role unspecified role n/a 1309073 unspecified role unspecified role unspecified role unspecified role n/a 1309071 unspecified role unspecified role unspecified role unspecified role n/a 1309070 unspecified role unspecified role unspecified role unspecified role n/a 1309075 unspecified role unspecified role unspecified role unspecified role n/a 1309074 unspecified role unspecified role unspecified role unspecified role n/a 1309072 unspecified role unspecified role unspecified role unspecified role association association false false false Fig 1C.