UniProt UniProt http://www.uniprot.org lee-2004i-2 Identification of the hypoxia-inducible factor 1 alpha-responsive HGTD-P gene as a mediator in the mitochondrial apoptotic pathway. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee M.J., Kim J.Y., Suk K., Park J.H. Origin of VDAC2 according used goat anti-VHC antibody. jhpark@kha.ac.kr jhpark@khu.ac.kr Mol. Cell. Biol. (0270-7306) 2004 Only protein-protein interactions imex curation lee-2004i-3 Identification of the hypoxia-inducible factor 1 alpha-responsive HGTD-P gene as a mediator in the mitochondrial apoptotic pathway. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee M.J., Kim J.Y., Suk K., Park J.H. Origin of VDAC2 according used goat anti-VHC antibody. jhpark@kha.ac.kr jhpark@khu.ac.kr Mol. Cell. Biol. (0270-7306) 2004 Only protein-protein interactions imex curation f162a_human Protein FAM162A FAM162A C3orf28 E2IG5 E2-induced gene 5 protein Growth and transformation-dependent protein DC16 FWP001 protein protein human Homo sapiens Human MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKKARLKEEAAMKAKTE vdac2_human Voltage-dependent anion-selective channel protein 2 VDAC2 Outer mitochondrial membrane protein porin 2 protein protein human Homo sapiens Human MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA vdac2-fam162a 1290932 n/a 1290934 unspecified role unspecified role prey prey n/a 1290935 unspecified role unspecified role bait bait physical association physical association false false false 7A fam162a-vdac2 1290933 n/a 1290935 unspecified role unspecified role prey prey n/a 1290934 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7B