UniProt UniProt http://www.uniprot.org kuwahara-2003-2 The apoptosis-inducing protein kinase DRAK2 is inhibited in a calcium-dependent manner by the calcium-binding protein CHP. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Kuwahara H., Kamei J., Nakamura N., Matsumoto M., Inoue H., Kanazawa H. The in vitro kinase assay in figures 1, 2 and 3 uses the substrate myosin light chain of bovine (Sigma), but it is not possible to know to which isoform it correspond. nnakamur@bio.sci.osaka-u.ac.jp J. Biochem. (0021-924X) 2003 Only protein-protein interactions imex curation kuwahara-2003-1 The apoptosis-inducing protein kinase DRAK2 is inhibited in a calcium-dependent manner by the calcium-binding protein CHP. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kuwahara H., Kamei J., Nakamura N., Matsumoto M., Inoue H., Kanazawa H. The in vitro kinase assay in figures 1, 2 and 3 uses the substrate myosin light chain of bovine (Sigma), but it is not possible to know to which isoform it correspond. nnakamur@bio.sci.osaka-u.ac.jp J. Biochem. (0021-924X) 2003 Only protein-protein interactions imex curation st17b_rat Serine/threonine-protein kinase 17B Stk17b Drak2 DAP kinase-related apoptosis-inducing protein kinase 2 protein protein rat Rattus norvegicus (Rat) Rat MSRRRFDCRSISGLLTTTPQTPMKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGSLFHPEETSESSQTQDLSLRSSEDKTPKSCNGSCGDREDKENIPEDDSLLSKRFRFDDSLPSPHELVPDLFC chp1_rat Calcineurin B homologous protein 1 Chp1 Calcineurin B-like protein Calcium-binding protein CHP Calcium-binding protein p22 Chp EF-hand calcium-binding domain-containing protein p22 protein protein rat Rattus norvegicus (Rat) Rat MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH stk17b-1 1295843 n/a 1295845 putative self putative self putative self putative self region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false true false 1 chp-stk17b-8 1295843 n/a 1295846 inhibitor inhibitor unspecified role unspecified role n/a 1295845 putative self putative self putative self putative self purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2, 3 and 4 stk17b-chp 1295844 n/a 1295846 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295845 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5