UniProt UniProt http://www.uniprot.org morris-2002-7 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-8 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-9 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-1 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-2 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-3 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast reverse rrs reverse ras recruitment system reverse RRS reverse rrs nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-4 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast reverse rrs reverse ras recruitment system reverse RRS reverse rrs predetermined predetermined participant predetermined Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-5 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-6 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-10 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation morris-2002-19 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton. rat-nrk Rattus norvegicus kidney fibroblast cell line NRK nrk Rat kidney fibroblast cell line NRK fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Morris S.M., Arden S.D., Roberts R.C., Kendrick-Jones J., Cooper J.A., Luzio J.P., Buss F. jcooper@fhcrc.org human umbilical vein epithelial cell cDNA Traffic (1398-9219) 2002 Only protein-protein interactions imex curation dab2_mouse Disabled homolog 2 Mitogen-responsive phosphoprotein Dab2 Doc2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein mouse Mus musculus Mouse MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKKVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGVTSCSLPRPKPQASFLPENAFSANLNFFPTPNPDPFRDDPFAQPDQSAPSSFDSLTSPDQKKASLSSSSTPQSKGPLNGDTDYFGQQFDQLSNRTGKPEAQGGPWPYPSSQTQQAVRTQNGVSEREQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSVQSSAHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFASEPPGQMSPTGQPAVPQSNFLDLFKGNAPAPVGPLVGLGTVPVTPPQAGPWTPVVYSPSTTVVPGAIISGQPPSFRQPLVFGTTPAVQVWNQSPSFATPASPPPPTVWCPTTSVAPNAWSSTSPLGNPFQSNNIFPPPTMSTQSSPQPMMSSVLATPPQPPPRNGPLKDIPSDAFTGLDPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPPSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPRQGVLLGTKSADNSLENPFSKGFSSSNPSVVSQPASSDPHRSPFGNPFA myo6_chick Unconventional myosin-VI MYO6 CMY6 Unconventional myosin-6 protein protein chick Gallus gallus (Chicken) Chicken MEDGKPVWAPHPTDGFQMGMIVDIGTDYLTIEPLNQKGKTFQAAINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKFYSSDAIKKYQGRSLGTLPPHVFAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTIRNNNSSRFGKFVEIHFNEKNSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGAPEDIREKLYLSSPDSFRYLNRGCTRYFATKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFNRMCTAMKKIGLDDAEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCTLKAQSQPALECCAALLGLDEEDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSFFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVRYVDNQDCIDLIEAKLIGVLDILDEENRLPQPSDQHFTSVVHQKHKDHFRLSIPRKSKLAVHRNVRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESKDKFVRQLFESNTNNNKDPKQKAGKLSFISVGNKFKTQLNLLLEKLHSTGSSFIRCIFPNLKMTSHHFEGGQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYLPEKLARLDPRLFCKALFKALGLNEIDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLICSRWKKVQWCSLSVIKLKNKIKYRASACIKIQKTIRMWLCKRKHKPRIDGLIKVRTLKKRLDKFNEVVSALKEGKAETSKQIKELEYSIDASMTKIKTTMMTREQIMKEYDALVRSSEQLLSALQKKKQQEEEAERLRRIQEEMEKERKRREEEEKRRRKEEEERRLKSEIEAKRKQEEEERKKREEEEKRIQAEIEAQLAREREEETQHQAILEQERRDRELAMRIAQTGAELSTEETKLDVGLCRANGTKLQMTAEQMAKEMSEMLSRGPAVQATKAAAGAKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNAETEQRAPKSVTDYAQQNPTAQLPMRQQEIEINRQQRYFRIPFIRPMDQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKAPILLVAGKDDMDMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQNLLK dab1_mouse Disabled homolog 1 Dab1 protein protein mouse Mus musculus Mouse MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPNSQPLEDFESRFAAATPNRNLSMDFDELLEATKVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPGSADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPSKSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS myo6_human Unconventional myosin-VI MYO6 KIAA0389 Unconventional myosin-6 protein protein human Homo sapiens Human MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYDALVKSSEELLSALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK ap2b1_human AP-2 complex subunit beta AP2B1 CLAPB1 Beta-2-adaptin Beta-adaptin Plasma membrane adaptor HA2/AP2 adaptin beta subunit Clathrin assembly protein complex 2 beta large chain AP105B Adaptor protein complex AP-2 subunit beta ADTB2 Adaptor-related protein complex 2 subunit beta protein protein human Homo sapiens Human MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN dab2_human Disabled homolog 2 DAB2 DOC2 Differentially-expressed protein 2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein human Homo sapiens Human MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSVQSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA dab2_rat Disabled homolog 2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 Dab2 Doc2 C9 Mitogen-responsive phosphoprotein protein protein rat Rattus norvegicus (Rat) Rat MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNNPTESRDILLVDLNSEIDTNQNSLRENPFLTNGVTSCSLPRPKPQASFLPESAFSANLNFFPTPNPDPFRDDPFAQPDQSAPSSFHSLTSADQKKANPGSLSTPQSKGPLNGDTDYFGQQFDQISNRTGKQEAQGGPWPYPSSQTQQAVRTQNGVSEKEQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSVQSSAHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFASEPPGQMSPTGQPAVPQANFMDLFKTSAPAPMGSGPLVGLGTVPVTPPQAGPWTPVVFTPSTTVVPGAIISGQPSGFGQPLVFGTTPAVQVWNQPSSFATAASPPPPAVWCPTTSVAPNTWSSTSPLGNPFQSSNIFPPSTISTQSFPQPMMSSVLVTPPQPPPRNGPLKDTLSDAFTGLDPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPSSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPRQGVLSGTKSADNSLENPFSKGFSSTNPSVVSQPASSDAHRSPFGNPFA myo6-dab2-3 1319568 n/a 1319579 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P98078:p.Ser682_Phe684delinsAlaAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P98078:p.Asp699_Asp701delinsAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1319580 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) physical association physical association false false false 2B and 5B C-terminal region of myoVI as indicated by the authors does not fully match with uniprot sequence myo6-dab1 1319568 n/a 1319580 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) n/a 1319581 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated P97318:p.Ser478_Phe480delinsAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 4A and 5C C-terminal region of myoVI as indicated by the authors does not fully match with uniprot sequence myo6-dab2-4 1319569 n/a 1319582 unspecified role unspecified role bait bait n/a 1319583 unspecified role unspecified role prey prey physical association physical association false false false 3A dab2-ap2b1 1319569 n/a 1319584 unspecified role unspecified role bait bait n/a 1319582 unspecified role unspecified role prey prey physical association physical association false false false 3A myo6-dab2-5 1319570 n/a 1319579 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1319582 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3B clathrin heavy chain also precipitated myo6-dab1-1 1319570 n/a 1319582 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1319581 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 4B clathrin heavy chain also precipitated myo6-dab2 1319571 n/a 1319580 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false n/a 1319584 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure myo6-dab2-1 1319572 n/a 1319584 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1319580 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false physical association physical association false false false 1A dab2-myo6-1 1319573 n/a 1319579 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1319582 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined c-term range C-terminal range c-term range false physical association physical association false false false no figure dab2-myo6-2 1319574 n/a 1319579 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1319582 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined c-term range C-terminal range c-term range false physical association physical association false false false 1B dab2-myo6-4 1319575 n/a 1319584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1319582 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1C myo6-dab2-2 1319576 n/a 1319579 unspecified role unspecified role prey prey cell lysate cell lysate mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells n/a 1319580 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 2A C-terminal region of myoVI as indicated by the authors does not fully match with uniprot sequence dab2-myo6-5 1319577 n/a 1319584 unspecified role unspecified role neutral component neutral component n/a 1319582 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6 dab2-myo6-6 1319578 n/a 1319580 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind range range range range false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1319585 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 7 and 8 C-terminal region of myoVI as indicated by the authors does not fully match with uniprot sequence