UniProt UniProt http://www.uniprot.org jones-2001-1 Multiple distinct targeting signals in integral peroxisomal membrane proteins. human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jones J.M., Morrell J.C., Gould S.J. sgould@jhmi.edu J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation pex19_human Peroxisomal biogenesis factor 19 PEX19 HK33 PXF OK/SW-cl.22 Peroxin-19 Peroxisomal farnesylated protein 33 kDa housekeeping protein protein protein human Homo sapiens Human MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM pm34_human Peroxisomal membrane protein PMP34 34 kDa peroxisomal membrane protein Solute carrier family 25 member 17 SLC25A17 PMP34 protein protein human Homo sapiens Human MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH pex19-slc25a17-3 1283185 n/a 1283186 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1283187 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7a and 7b