mbinfo MBInfo http://www.mechanobio.info/ http://www.mechanobio.info/ weed-2000-2 Cortactin localization to sites of actin assembly in lamellipodia requires interactions with F-actin and the Arp2/3 complex. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Weed S.A., Karginov A.V., Schafer D.A., Weaver A.M., Kinley A.W., Cooper J.A., Parsons J.T. The interactions between cortactin and F-actin could not be curated since the number of actin subunits in F-actin is not known. Interaction detection method: GST pull down. Participant detection method: LC-MS. The source of cortactin and Arp2/3 complex specified by the author. jtp@virginia.edu J. Cell Biol. (0021-9525) 2000 Only protein-protein interactions imex curation The colocalization experiment from Fig 8 could not be curated since the cortactin, Arp3 and p21-Arc endogenous proteins in PtK1 cells (kidney cells of Potorous tridactylus) could not be found. weed-2000-1 Cortactin localization to sites of actin assembly in lamellipodia requires interactions with F-actin and the Arp2/3 complex. in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Weed S.A., Karginov A.V., Schafer D.A., Weaver A.M., Kinley A.W., Cooper J.A., Parsons J.T. The interactions between cortactin and F-actin could not be curated since the number of actin subunits in F-actin is not known. Interaction detection method: GST pull down. Participant detection method: LC-MS. The source of cortactin and Arp2/3 complex specified by the author. jtp@virginia.edu J. Cell Biol. (0021-9525) 2000 Only protein-protein interactions imex curation The colocalization experiment from Fig 8 could not be curated since the cortactin, Arp3 and p21-Arc endogenous proteins in PtK1 cells (kidney cells of Potorous tridactylus) could not be found. weed-2000-3 Cortactin localization to sites of actin assembly in lamellipodia requires interactions with F-actin and the Arp2/3 complex. mouse-c3h10t1_2 Mouse embryonic fibroblast C3H10T1_2 c3h10t1_2 Mouse mesenchymal stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Weed S.A., Karginov A.V., Schafer D.A., Weaver A.M., Kinley A.W., Cooper J.A., Parsons J.T. The interactions between cortactin and F-actin could not be curated since the number of actin subunits in F-actin is not known. Interaction detection method: GST pull down. Participant detection method: LC-MS. The source of cortactin and Arp2/3 complex specified by the author. jtp@virginia.edu J. Cell Biol. (0021-9525) 2000 Only protein-protein interactions imex curation The colocalization experiment from Fig 8 could not be curated since the cortactin, Arp3 and p21-Arc endogenous proteins in PtK1 cells (kidney cells of Potorous tridactylus) could not be found. arpc2_mouse Actin-related protein 2/3 complex subunit 2 Arp2/3 complex 34 kDa subunit Arpc2 protein protein mouse Mus musculus Mouse MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPEPGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNATARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR arp3_mouse Actin-related protein 3 Actin-like protein 3 Actr3 Arp3 protein protein mouse Mus musculus Mouse MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS src8_mouse Src substrate cortactin Cttn Ems1 protein protein mouse Mus musculus Mouse MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ arp3_bovin Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 Actin-2 protein protein bovin Bos taurus (Bovine) Bovine MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS arpc3_mouse Actin-related protein 2/3 complex subunit 3 Arp2/3 complex 21 kDa subunit Arpc3 protein protein mouse Mus musculus Mouse MPAYHSSLMDPDTKLIGNMALLPLRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPASKQEDEMMRAYLQQLRQETGLRLCEKVFDPQSDKPSKWWTCFVKRQFMNKSLSGPGQ arpc4_mouse Actin-related protein 2/3 complex subunit 4 Arp2/3 complex 20 kDa subunit Arpc4 Arc20 protein protein mouse Mus musculus Mouse MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF arp2_mouse Actin-related protein 2 Actin-like protein 2 Actr2 Arp2 protein protein mouse Mus musculus Mouse MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR cttn-actr3-6 1307132 n/a 1307135 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1307136 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1307137 unspecified role unspecified role bait bait n-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false Fig 5B. cttn-actr3-1 1307132 n/a 1307136 unspecified role unspecified role prey prey mouse-c3h10t1_2 Mouse embryonic fibroblast C3H10T1_2 c3h10t1_2 Mouse mesenchymal stem cells n/a 1307137 unspecified role unspecified role bait bait n-terminal acidic region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 6A. cttn-actr3-5 1307132 n/a 1307138 unspecified role unspecified role prey prey bovin-brain Bos taurus brain brain Brain [cerebrum] n/a 1307137 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal acidic region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1307132 Fig 7A, 7B. Arp3 bound to cortactin-N terminal repeat 5 was detected by western blot and the affinity of binding was measured by densitometry. The Kd value of 1.3 micromolars was determined for the Arp3 binding to the cortactin-N terminal repeat 5 [1-269] fragment. actr2-actr3-1 1307133 n/a 1307139 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1307137 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1307140 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1307141 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1307135 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1307136 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] association association false false false Fig 5A. cttn-actr3-3 1307134 n/a 1307136 unspecified role unspecified role prey prey n/a 1307137 unspecified role unspecified role bait bait n-terminal acidic region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 6B.