UniProt UniProt http://www.uniprot.org nicol-2000-2 The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation nicol-2000-4 The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation nicol-2000-1 The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation nicol-2000-3 The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation nicol-2000-5 The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. confocal microscopy confocal microscopy immunostaining immunostaining Nicol S.M., Causevic M., Prescott A.R., Fuller-Pace F.V. Colocalization exp involving CHO UBF (fig 3r) omitted since protein identity cannot be established from used antibody (UBF1 or UBF2).. f.v.fullerpace@dundee.ac.uk WI-38 human lung fibroblast cell line cDNA library Exp. Cell Res. (0014-4827) 2000 mimix curation fbrl_human rRNA 2'-O-methyltransferase fibrillarin FBL FIB1 FLRN Histone-glutamine methyltransferase 34 kDa nucleolar scleroderma antigen U6 snRNA 2'-O-methyltransferase fibrillarin protein protein human Homo sapiens Human MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN ddx5_human Probable ATP-dependent RNA helicase DDX5 HLR1 DDX5 HELR G17P1 DEAD box protein 5 RNA helicase p68 protein protein human Homo sapiens Human MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ g3hct4_crigr DEAD box protein 5 Probable ATP-dependent RNA helicase DDX5 I79_008300 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVANMHNGMNQQAYAYPATAAAAPMIGYPMPTGYSQ a0a3l7h5s4_crigr CgPICR_018616 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN similar to mouse Fbl UniProt entry AC P35550 fbl-ddx5 1268051 n/a 1268056 unspecified role unspecified role bait bait n/a 1268057 unspecified role unspecified role prey prey physical association physical association false false false 1a ddx5-fbl-1 1268051 n/a 1268057 unspecified role unspecified role bait bait n/a 1268056 unspecified role unspecified role prey prey physical association physical association false false false 1b fbl-ddx5-1 1268052 n/a 1268056 unspecified role unspecified role bait bait n/a 1268057 unspecified role unspecified role prey prey physical association physical association false false false 4a ddx5-fbl-3 1268052 n/a 1268057 unspecified role unspecified role bait bait n/a 1268056 unspecified role unspecified role prey prey physical association physical association false false false 4b ddx5-fbl 1268053 n/a 1268057 unspecified role unspecified role bait bait n/a 1268056 unspecified role unspecified role prey prey physical association physical association false false false no figure ddx5-fbl-2 1268054 n/a 1268057 unspecified role unspecified role neutral component neutral component n/a 1268056 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2f ddx5-fbl-4 1268055 n/a 1268058 unspecified role unspecified role neutral component neutral component n/a 1268059 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2f and 3m/y