MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint hirano-1995-1 Interaction of the ribosomal protein, L5, with protein phosphatase type 1. in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Hirano K., Ito M., Hartshorne DJ. J. Biol. Chem. (0021-9258) 1995 partial coverage rapid curation hirano-1995-2 Interaction of the ribosomal protein, L5, with protein phosphatase type 1. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hirano K., Ito M., Hartshorne DJ. J. Biol. Chem. (0021-9258) 1995 partial coverage rapid curation pp1b_rat Serine/threonine-protein phosphatase PP1-beta catalytic subunit Ppp1cb protein protein rat Rattus norvegicus (Rat) Rat MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR rl5_rat 60S ribosomal protein L5 Rpl5 protein protein rat Rattus norvegicus (Rat) Rat MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVNGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES ppp1cb-rpl5 1230634 pp1b_rat 1230636 unspecified role unspecified role neutral component neutral component rl5_rat 1230637 unspecified role unspecified role neutral component neutral component physical association physical association false false false mint F1; F5 ppp1cb-rpl5-1 1230635 rl5_rat 1230637 unspecified role unspecified role prey prey pp1b_rat 1230636 unspecified role unspecified role bait bait physical association physical association false false false F1 mint