MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ghodke-2012-1 Mapping out the multistage fibrillation of glucagon. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Ghodke S., Nielsen SB., Christiansen G., Hjuler HA., Flink J., Otzen D. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation ghodke-2012-2 Mapping out the multistage fibrillation of glucagon. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Ghodke S., Nielsen SB., Christiansen G., Hjuler HA., Flink J., Otzen D. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation ghodke-2012-3 Mapping out the multistage fibrillation of glucagon. in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ghodke S., Nielsen SB., Christiansen G., Hjuler HA., Flink J., Otzen D. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation gluc_human Pro-glucagon GCG protein protein human Homo sapiens Human MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK mint homomint gcg-gcg 1251956 gluc_human Glucagon 1251959 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gluc_human Glucagon 1251959 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f1 f2a t1 sf1 sf2 sf3 sf4 st1 st2 gcg-gcg-1 1251957 gluc_human Glucagon 1251959 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gluc_human Glucagon 1251959 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f2 t1 sf6 st2 gcg-gcg-2 1251958 gluc_human Glucagon 1251959 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gluc_human Glucagon 1251959 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f4 t1 sf5 st2