MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint t_moin-2012-1 Signal peptide of FadA adhesin from Fusobacterium nucleatum plays a novel structural role by modulating the filament's length and width. in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Témoin S., Wu KL., Wu V., Shoham M., Han YW. FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation q5i6b0_fusnu fadA DNF10_04660 protein protein fusnu Fusobacterium nucleatum MKKFLLLAVLAVSASAFAATDAASLVGELQALDAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEAEMEQQKAVISDFEKIQALRAGN mint fada-fada 1233668 fada mFadA 1233669 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fada pre-FadA 1233669 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F5 mint