MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zhong-2012a-3 Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhong J., Cao RX., Zu XY., Hong T., Yang J., Liu L., Xiao XH., Ding WJ., Zhao Q., Liu JH., Wen GB. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation zhong-2012a-1 Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Zhong J., Cao RX., Zu XY., Hong T., Yang J., Liu L., Xiao XH., Ding WJ., Zhao Q., Liu JH., Wen GB. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation zhong-2012a-2 Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Zhong J., Cao RX., Zu XY., Hong T., Yang J., Liu L., Xiao XH., Ding WJ., Zhao Q., Liu JH., Wen GB. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation zhong-2012a-4 Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhong J., Cao RX., Zu XY., Hong T., Yang J., Liu L., Xiao XH., Ding WJ., Zhao Q., Liu JH., Wen GB. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation zhong-2012a-5 Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhong J., Cao RX., Zu XY., Hong T., Yang J., Liu L., Xiao XH., Ding WJ., Zhao Q., Liu JH., Wen GB. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV anm2_human Protein arginine N-methyltransferase 2 PRMT2 HMT1 Histone-arginine N-methyltransferase PRMT2 HRMT1L1 protein protein human Homo sapiens Human MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR aldr_human Aldo-keto reductase family 1 member B1 Aldehyde reductase ALR2 Aldose reductase AKR1B1 ALDR1 protein protein human Homo sapiens Human MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF prmt2-esr1 1240272 esr1_human ER-alpha 1240277 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified anm2_human PRMT2 1240278 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f6a homomint mint prmt2-esr1-1 1240272 esr1_human ER-alpha 1240277 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level anm2_human PRMT2 1240278 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f7b homomint mint esr1-prmt2 1240273 esr1_human ER-alpha 1240277 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell anm2_human PRMT2 1240278 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f2a homomint mint akr1b1-prmt2 1240274 aldr_human AR 1240279 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell anm2_human PRMT2 1240278 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f3 homomint mint prmt2-esr1-2 1240275 anm2_human PRMT2 1240278 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false esr1_human ER-alpha 1240277 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f6b homomint mint prmt2-akr1b1 1240276 aldr_human AR 1240279 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level anm2_human PRMT2 1240278 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f6c homomint mint