MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint masuyer-2012-1 Inhibition mechanism of human galectin-7 by a novel galactose-benzylphosphate inhibitor. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Masuyer G., Jabeen T., Öberg CT., Leffler H., Nilsson UJ., Acharya KR. FEBS J. (1742-464X) 2012 Only protein-protein interactions imex curation leg7_human Galectin-7 LGALS7 PIG1 HKL-14 PI7 p53-induced gene 1 protein LGALS7B protein protein human Homo sapiens Human MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF lgals7-1 1233664 leg7_human hGal-7 1233665 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 direct interaction direct interaction false false false mint t2 f1 sf2