IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mullen-2011-2 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-7 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-12 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-13 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-38b9 Mouse 38B9 38b9 Murine 38B9 Pro-B Cells ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-5 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. Re-ChiP experiment in which proteins are first precipitated by antibodies to one protein (prey) and then to a second (bait) young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-8 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-9 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-38b9 Mouse 38B9 38b9 Murine 38B9 Pro-B Cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-1 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. human-embryonic_stem_ cells Human-embryonic_stem_ cells (es cells) embryonic_stem_cell Embryonic stem cell (es cells) ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-4 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-3 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. Proteins are cross-linked with formaldehyde and will be associated in a chromatin complex. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-6 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-10 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation mullen-2011-11 Master Transcription Factors Determine Cell-Type-Specific Responses to TGF-β Signaling. mouse-38b9 Mouse 38B9 38b9 Murine 38B9 Pro-B Cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mullen A.C., Orlando D.A., Newman J.J., Loven J., Kumar R.M., Bilodeau S., Reddy J., Guenther M.G., Dekoter R.P., Young R.A. young@wi.mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation po5f1_mouse_gene POU domain, class 5, transcription factor 1 gene gene mouse Mus musculus Mouse po5f1_mouse POU domain, class 5, transcription factor 1 Pou5f1 Oct-3 Oct-4 Otf-3 Otf3 Octamer-binding transcription factor 3 NF-A3 Octamer-binding protein 3 Octamer-binding protein 4 protein protein mouse Mus musculus Mouse MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPGGPGIGPGSEVLGISPCPPAYEFCGGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSEPCADRPNAVKLEKVEPTPEESQDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPGGAVSFPLPPGPHFGTPGYGSPHFTTLYSVPFPEGEAFPSVPVTALGSPMHSN lfty1_mouse_gene Left-right determination factor 1 gene gene gene mouse Mus musculus Mouse sox2_mouse Transcription factor SOX-2 Sox2 Sox-2 protein protein mouse Mus musculus Mouse MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAKYGTLPLSHM nanog_mouse Homeobox protein NANOG Nanog Ecat4 Enk Homeobox transcription factor Nanog Early embryo specific expression NK-type homeobox protein ES cell-associated protein 4 protein protein mouse Mus musculus Mouse MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS lfty2_mouse_gene Left-right determination factor 2 gene gene gene mouse Mus musculus Mouse mef2d_mouse_gene Myocyte-specific enhancer factor 2D gene gene gene mouse Mus musculus Mouse myod1_mouse Myoblast determination protein 1 Myod1 Myod protein protein mouse Mus musculus Mouse MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFEDLDPRLVHMGALLKPEEHAHFPTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPPGRGSEHYSGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSEAARESRPGKSAAVSSLDCLSSIVERISTDSPAAPALLLADAPPESPPGPPEGASLSDTEQGTQTPSPDAAPQCPAGSNPNAIYQVL kcrm_mouse_gene Mouse Creatine kinase M-type gene gene gene mouse Mus musculus Mouse Creatine kinase M-type max_mouse_gene Max gene gene mouse Mus musculus Mouse sox2_mouse_gene Sox2 gene gene gene mouse Mus musculus Mouse id3_mouse_gene DNA-binding protein inhibitor ID-3 gene gene gene mouse Mus musculus Mouse pmepa_mouse_gene Transmembrane prostate androgen-induced protein gene gene gene mouse Mus musculus Mouse tdgf1_mouse_gene Teratocarcinoma-derived growth factor gene gene gene mouse Mus musculus Mouse nodal_mouse_gene Nodal gene gene gene mouse Mus musculus Mouse smad7_mouse_gene Mouse Smad7 gene gene gene mouse Mus musculus Mouse ep300_mouse Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 Ep300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein mouse Mus musculus Mouse MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAMASQAQQNSPGLSLINSMVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGPQPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGMPSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQIPPQPQVQAKNQQSQPSGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINSQNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMNMPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTNMPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTPTPHHTPPSIGNQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSLPAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTEVNSQTIPEKQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKTDGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAPGQVTPPTPPQTAQAPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMSPMAPMGMNPPPMARGPGGHLDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQPLPGQPGMTQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMGAMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADLNSNLSQSTLDIH aa1r_mouse_gene Adenosine receptor A1 gene gene gene mouse Mus musculus Mouse ari3a_mouse_gene AT-rich interactive domain-containing protein 3A gene gene gene mouse Mus musculus Mouse spi1_mouse Transcription factor PU.1 Spi1 Sfpi1 Sfpi-1 31 kDa-transforming protein SFFV proviral integration 1 protein protein protein mouse Mus musculus Mouse MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHYWDFSAHHVHNNEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSHQVSYMPRMCFPYQTLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRLPPH vpre2_mouse_gene Immunoglobulin omega chain gene gene gene mouse Mus musculus Mouse myod1_mouse_gene Myoblast determination protein 1 gene gene gene mouse Mus musculus Mouse pnmt_mouse_gene Phenylethanolamine N-methyltransferase gene gene gene mouse Mus musculus Mouse id2_mouse_gene Mouse Id2 gene gene gene mouse Mus musculus Mouse junb_mouse_gene Mouse JunB gene gene gene mouse Mus musculus Mouse desm_mouse_gene Desmin gene gene gene mouse Mus musculus Mouse tnr19_mouse_gene Tumor necrosis factor receptor superfamily member 19 gene gene mouse Mus musculus Mouse rag2_mouse_gene Rag2 gene gene gene mouse Mus musculus Mouse jund_mouse_gene Mouse Jund gene gene gene mouse Mus musculus Mouse il2ra_mouse_gene Interleukin-2 receptor subunit alpha gene gene gene mouse Mus musculus Mouse po5f1_human_gene Human POU domain, class 5, transcription factor 1 gene gene gene human Homo sapiens Human po5f1_human POU domain, class 5, transcription factor 1 Octamer-binding transcription factor 3 Octamer-binding protein 3 POU5F1 OCT3 OCT4 OTF3 Octamer-binding protein 4 protein protein human Homo sapiens Human MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS lfty1_human_gene Human left-right determination factor 1 gene gene gene human Homo sapiens Human smad4_mouse Mothers against decapentaplegic homolog 4 Smad4 Dpc4 Madh4 Deletion target in pancreatic carcinoma 4 homolog SMAD family member 4 protein protein mouse Mus musculus Mouse MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD lfty1_mouse _enhancer_5-3 Murine Lefty1 enhancer (5-3 prime) dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse GGTGGGAGGGAGACTGCCCTTTGTCATGTAGAAGGAGCTT pou5f1-po5f1-1 1233855 n/a 1233868 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233869 unspecified role unspecified role bait bait association association false false false Smad3, the Smad2/3 complex, Pou5f1/Oct4, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 1G, Supp. Fig. 2B pou5f1-lfty1-2 1233855 n/a 1233870 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233869 unspecified role unspecified role bait bait association association false false false Smad3, the Smad2/3 complex, Pou5f1/Oct4, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 1G, Supp. Fig. 2B sox2-po5f1-1 1233855 n/a 1233868 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233871 unspecified role unspecified role bait bait association association false false false Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Supp. Fig. 2B nanog-po5f1 1233855 n/a 1233872 unspecified role unspecified role bait bait n/a 1233868 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Supp. Fig. 2B smad3-po5f1-1 1233855 n/a 1233868 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 1G, Supp. Fig. 2B sox2-lfty1 1233855 n/a 1233870 unspecified role unspecified role prey prey n/a 1233871 unspecified role unspecified role bait bait association association false false false Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Supp. Fig. 2B nanog-lfty1 1233855 n/a 1233872 unspecified role unspecified role bait bait n/a 1233870 unspecified role unspecified role prey prey association association false false false Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Supp. Fig. 2B smad3-lfty1-1 1233855 n/a 1233870 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Smad3, the Smad2/3 complex, Pou5f1/Oct4, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 1G, Supp. Fig. 2B smad3-lfty2 1233855 n/a 1233874 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. Fig. 7D smad3-mef2d 1233855 n/a 1233875 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. Fig. 7E myod1-mef2d 1233855 n/a 1233875 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233876 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. Fig. 7E myod1-kcrm 1233855 n/a 1233876 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233877 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Smad3, the Smad2/3 complex, Pou5f1, Sox2, Nanog, binds to the same region of the pou5f1 gene. Fig. 7E smad3-kcrm 1233855 n/a 1233877 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. Fig. 7E pou5f1-max 1233855 n/a 1233869 unspecified role unspecified role bait bait n/a 1233878 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2A Smad3, Pou5f1, Sox2 and Nanog co-occupy sites on the Max gene sox2-max 1233855 n/a 1233871 unspecified role unspecified role bait bait n/a 1233878 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2A Smad3, Pou5f1, Sox2 and Nanog co-occupy sites on the Max gene nanog-max 1233855 n/a 1233872 unspecified role unspecified role bait bait n/a 1233878 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2A Smad3, Pou5f1, Sox2 and Nanog co-occupy sites on the Max gene smad3-max 1233855 n/a 1233873 unspecified role unspecified role bait bait n/a 1233878 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2A Smad3, Pou5f1, Sox2 and Nanog co-occupy sites on the Max gene pou5f1-sox2 1233855 n/a 1233879 unspecified role unspecified role prey prey n/a 1233869 unspecified role unspecified role bait bait association association false false false Fig. 4D smad3-sox2 1233855 n/a 1233879 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 4D smad3-id3 1233855 n/a 1233873 unspecified role unspecified role bait bait n/a 1233880 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5B pou5f1-id3 1233855 n/a 1233880 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233869 unspecified role unspecified role bait bait association association false false false Fig. 5B smad3-pmepa 1233855 n/a 1233881 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 5B pou5f1-pmepa 1233855 n/a 1233869 unspecified role unspecified role bait bait n/a 1233881 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5B smad3-tdgf1 1233855 n/a 1233882 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 7D Smad3 continued to occupy sites with Oct4 in the setting of Myod1 expression. pou5f1-tdgf1 1233855 n/a 1233869 unspecified role unspecified role bait bait n/a 1233882 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7D smad3-nodal-2 1233856 n/a 1233869 unspecified role unspecified role ancillary ancillary n/a 1233883 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 3F Smad3 does not bind in the absence of Pou5f1. smad3-smad7-2 1233856 n/a 1233884 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233869 unspecified role unspecified role ancillary ancillary n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 3F Smad3 does not bind in the absence of Pou5f1. smad3-lfty1-4 1233856 n/a 1233869 unspecified role unspecified role ancillary ancillary n/a 1233873 unspecified role unspecified role bait bait n/a 1233870 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3F Smad3 does not bind in the absence of Pou5f1. smad3-lfty2-2 1233856 n/a 1233874 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233869 unspecified role unspecified role ancillary ancillary n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 3F Smad3 does not bind in the absence of Pou5f1. smad3-pou5f1-2 1233856 n/a 1233868 unspecified role unspecified role ancillary ancillary region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233869 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 3F Smad3 does not bind in the absence of Pou5f1. ep300-lfty1 1233856 n/a 1233870 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233885 unspecified role unspecified role bait bait association association false false false fig. 6C This interaction requires activation of the TGF-beta pathway. ep300-lfty2 1233856 n/a 1233874 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233885 unspecified role unspecified role bait bait association association false false false fig. 6C This interaction requires activation of the TGF-beta pathway. ep300-smad7 1233856 n/a 1233884 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233885 unspecified role unspecified role bait bait association association false false false fig. 6C This interaction requires activation of the TGF-beta pathway. ep300-po5f1 1233856 n/a 1233868 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233885 unspecified role unspecified role bait bait association association false false false fig. 6C This interaction requires activation of the TGF-beta pathway. myod1-mef2d-1 1233857 n/a 1233875 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233876 unspecified role unspecified role bait bait association association false false false Fig. 7E myod1-kcrm-1 1233857 n/a 1233876 unspecified role unspecified role bait bait n/a 1233877 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7E smad3-aa1r 1233857 n/a 1233886 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 4D myod1-aa1r 1233857 n/a 1233886 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233876 unspecified role unspecified role bait bait association association false false false Fig. 4D smad3-ari3a 1233857 n/a 1233887 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 5B myod1-ari3a 1233857 n/a 1233887 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233876 unspecified role unspecified role bait bait association association false false false Fig. 5B smad3-pmepa-1 1233857 n/a 1233881 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 5B myod1-pmepa 1233857 n/a 1233881 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233876 unspecified role unspecified role bait bait association association false false false Fig. 5B smad3-ari3a-1 1233858 n/a 1233887 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 5B spi1-ari3a 1233858 n/a 1233888 unspecified role unspecified role bait bait n/a 1233887 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5B smad3-vpre2 1233858 n/a 1233889 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 4D spi1-vpre2 1233858 n/a 1233888 unspecified role unspecified role bait bait n/a 1233889 unspecified role unspecified role prey prey association association false false false Fig. 4D smad3-id3-1 1233858 n/a 1233873 unspecified role unspecified role bait bait n/a 1233880 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5B spi1-id3 1233858 n/a 1233888 unspecified role unspecified role bait bait n/a 1233880 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5B smad3-lfty1-2 1233859 n/a 1233873 unspecified role unspecified role bait bait n/a 1233869 unspecified role unspecified role prey prey n/a 1233870 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad3-lfty2 1233859 n/a 1233874 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait n/a 1233869 unspecified role unspecified role prey prey association association false false false Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad3-nodal 1233859 n/a 1233873 unspecified role unspecified role bait bait n/a 1233869 unspecified role unspecified role prey prey n/a 1233883 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad7-pou5f1 1233859 n/a 1233884 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait n/a 1233869 unspecified role unspecified role prey prey association association false false false Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad3-po5f1-2 1233859 n/a 1233869 unspecified role unspecified role prey prey n/a 1233868 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 3C Smad3 and Oct4 bind DNA sites at the same time. smad3-myod1-3 1233860 n/a 1233876 unspecified role unspecified role ancillary ancillary n/a 1233890 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-pnmt 1233860 n/a 1233876 unspecified role unspecified role ancillary ancillary n/a 1233873 unspecified role unspecified role bait bait n/a 1233891 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-id2 1233860 n/a 1233873 unspecified role unspecified role bait bait n/a 1233876 unspecified role unspecified role ancillary ancillary n/a 1233892 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-junb 1233860 n/a 1233893 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233876 unspecified role unspecified role ancillary ancillary n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-desm 1233860 n/a 1233894 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233876 unspecified role unspecified role ancillary ancillary n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. S3C Knockdown of Myod1 resulted in decreased Smad3 occupancy at the gene loci. smad3-tnfrsf19 1233861 n/a 1233895 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3D Deletion of Sfpi1(PU.1) and Spib result in reduced Smad3 binding smad3-vpre2-2 1233861 n/a 1233889 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3D Deletion of Sfpi1(PU.1) and Spib result in reduced Smad3 binding. smad3-rag2 1233861 n/a 1233873 unspecified role unspecified role bait bait n/a 1233896 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 3D Deletion of Sfpi1(PU.1) and Spib result in reduced Smad3 binding smad3-jund-1 1233861 n/a 1233897 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3D Deletion of Sfpi1(PU.1) and Spib result in reduced Smad3 binding. smad3-il2ra-1 1233861 n/a 1233898 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3D Smad3 occupancy increases with loss of PU.1 and Spib at Il2ra. pou5f1-po5f1 1233862 n/a 1233899 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233900 unspecified role unspecified role bait bait association association false false false Fig. 1B POU5F1/OCT4 binds to the same region of the pou5f1 gene as SMAD3. smad3-po5f1 1233862 n/a 1233899 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233901 unspecified role unspecified role bait bait association association false false false Fig. 1B SMAD3 binds to the same region of the pou5f1 gene as POU5F1/OCT4. smad3-lfty1 1233862 n/a 1233902 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233901 unspecified role unspecified role bait bait association association false false false Fig. 1B SMAD3 binds to the same region of the lefty1 gene as OCT4/POU5F1. pou5f1-lfty1-1 1233862 n/a 1233902 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1233900 unspecified role unspecified role bait bait association association false false false Fig. 1B POU5F1/OCT4 binds to the same region of the lefty1 gene as SMAD3. smad3-pou5f1-1 1233863 n/a 1233869 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3B Interaction is dependent on TGF-β signaling. smad3-pou5f1-3 1233863 n/a 1233869 unspecified role unspecified role prey prey n/a 1233903 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 4G smad3-pou5f1 1233864 n/a 1233869 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 3A lfty1-lfty1 1233865 n/a 1233873 unspecified role unspecified role neutral component neutral component mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells n/a 1233869 unspecified role unspecified role neutral component neutral component mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells n/a 1233904 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 3D This interaction is dependent on TGF-β signaling. smad3-myod1 1233866 n/a 1233873 unspecified role unspecified role bait bait n/a 1233903 unspecified role unspecified role prey prey n/a 1233876 unspecified role unspecified role prey prey association association false false false Fig. 4G smad3-myod1-2 1233867 n/a 1233888 unspecified role unspecified role prey prey n/a 1233903 unspecified role unspecified role prey prey n/a 1233873 unspecified role unspecified role bait bait association association false false false Fig. 4G