MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint yamasaki-2011-2 Molecular basis of α1-antitrypsin deficiency revealed by the structure of a domain-swapped trimer. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Yamasaki M., Sendall TJ., Pearce MC., Whisstock JC., Huntington JA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation yamasaki-2011-1 Molecular basis of α1-antitrypsin deficiency revealed by the structure of a domain-swapped trimer. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yamasaki M., Sendall TJ., Pearce MC., Whisstock JC., Huntington JA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation yamasaki-2011-3 Molecular basis of α1-antitrypsin deficiency revealed by the structure of a domain-swapped trimer. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Yamasaki M., Sendall TJ., Pearce MC., Whisstock JC., Huntington JA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK serpina1-serpina1-2 1244618 a1at_human a1AT 1244621 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified a1at_human a1AT 1244621 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false homomint mint f1 sf4b serpina1-serpina1-3 1244618 a1at_human a1AT 1244621 weight silver stain molecular weight estimation by silver staining weight silver stain unspecified role unspecified role neutral component neutral component purified purified a1at_human a1AT 1244621 weight silver stain molecular weight estimation by silver staining weight silver stain unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false homomint mint f1 sf4b f3b sf2 serpina1-2 1244619 a1at_human a1AT 1244621 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 3.0 direct interaction direct interaction false false false mint t1 f2b f2c f2d sf3 serpina1-serpina1-4 1244620 a1at_human a1AT 1244621 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified a1at_human a1AT 1244621 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false homomint mint f3a sf5a