IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2011e-1 Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation zhang-2011e-2 Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. in vitro In vitro protease assay protease assay tag fluorescence tag visualisation by fluorescence tag fluorescence Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation zhang-2011e-3 Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation zhang-2011e-4 Structural Switching of Staphylococcus aureus Clp Protease: A KEY TO UNDERSTANDING PROTEASE DYNAMICS. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang J., Ye F., Lan L., Jiang H., Luo C., Yang C.G. The N-terminal sequence of N-2-SaClpP is GSMNLIPTVI cluo@mail.shcnc.ac.cn, yangcg@mail.shcnc.ac.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation clpp_staaw ATP-dependent Clp protease proteolytic subunit clpP Endopeptidase Clp MW0730 protein protein staaw Staphylococcus aureus (strain MW2) MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK suc-ly-amc N-succinyl-Leu-Tyr-7-amido-4-methylcoumarin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ssra_peptide SSRA peptide tag peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) AANDENYALAA clpp-1 1240578 n/a 1240582 unspecified role unspecified role neutral component neutral component P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 7.0 direct interaction direct interaction false false false Fig.1A, Supp. fig. 1A clpp-2 1240578 n/a 1240582 unspecified role unspecified role neutral component neutral component P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 14.0 direct interaction direct interaction false false false Fig.1A clpp-3 1240578 n/a 1240582 unspecified role unspecified role neutral component neutral component Stoichiometry: 14.0 direct interaction direct interaction false false false Fig.1A clpp-4 1240578 n/a 1240582 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 14.0 direct interaction direct interaction false false false Fig.1A, Supp Fig. 1B clpp-5 1240578 n/a 1240582 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 7.0 direct interaction direct interaction false false false Fig.1A, Supp. Fig. 1B Under high salt conditions the tetradecameric structure becomes heptameric. clpp-suc_ly_amc 1240579 n/a 1240583 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1240582 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage false false false 1240579 Fig.1B clpp-suc_ly_amc-1 1240579 n/a 1240582 enzyme enzyme unspecified role unspecified role P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1240583 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) cleavage cleavage reaction cleavage false false false 1240579 Fig.1B clpp-suc_ly_amc-2 1240579 n/a 1240583 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1240582 enzyme enzyme unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 14.0 cleavage cleavage reaction cleavage false false false 1240579 Fig.1B clpp-ssra 1240580 n/a 1240584 enzyme target enzyme target substrate substrate unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1240582 enzyme enzyme unspecified role unspecified role P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage false false false Fig.1C clpp-ssra-1 1240580 n/a 1240584 enzyme target enzyme target substrate substrate unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1240582 enzyme enzyme unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 14.0 cleavage cleavage reaction cleavage false false false Fig.1C clpp-1 1240581 n/a 1240582 unspecified role unspecified role neutral component neutral component P63786:p.Met1delinsGlySerMet mutation mutation insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 14.0 direct interaction direct interaction false false false Table 1 2.28A Rworking = 22.4% Rfree = 26.9%