MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint downard-2011-1 Homology-modelled structure of the βB2B3-crystallin heterodimer studied by ion mobility and radical probe MS. in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Downard KM., Kokabu Y., Ikeguchi M., Akashi S. k.downard@sydney.edu.au FEBS J. (1742-464X) 2011 Only protein-protein interactions imex curation crbb2_bovin Beta-crystallin B2 CRYBB2 Beta-B2 crystallin Beta-crystallin Bp protein protein bovin Bos taurus (Bovine) Bovine MASDHQTQAGKPQPLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKITLYENPNFTGKKMEVIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSGDFGAPQPQVQSVRRIRDMQWHQRGAFHPSS mint Crystallins are the dominant structural components of the vertebrate eye lens crbb3_bovin Beta-crystallin B3 CRYBB3 Beta-B3 crystallin protein protein bovin Bos taurus (Bovine) Bovine MAEQHSTPEQAAAGKSHGGLGGSYKVIVYEMENFQGKRCELTAECPNLTESLLEKVGSIQVESGPWLAFERRAFRGEQYVLEKGDYPRWDAWSNSHHSDSLLSLRPLHIDGPDHKLHLFENPAFGGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRHWNEWDANQPQLQSVRRIRDQKWHKRGVFLSS mint Crystallins are the dominant structural components of the vertebrate eye lens crybb2-crybb3 1173358 crbb2_bovin Beta-crystallin B2 1173359 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified crbb3_bovin Beta-crystallin B3 1173360 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false homomint mint f2 f3 f4 crybb2-1 1173358 crbb2_bovin Beta-crystallin B2 1173359 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint f2 f3 f4