MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint dupeux-2011-1 A thermodynamic switch modulates abscisic acid receptor sensitivity. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dupeux F., Santiago J., Betz K., Twycross J., Park SY., Rodriguez L., Gonzalez-Guzman M., Jensen MR., Krasnogor N., Blackledge M., Holdsworth M., Cutler SR., Rodriguez PL., Márquez JA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation dupeux-2011-3 A thermodynamic switch modulates abscisic acid receptor sensitivity. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Dupeux F., Santiago J., Betz K., Twycross J., Park SY., Rodriguez L., Gonzalez-Guzman M., Jensen MR., Krasnogor N., Blackledge M., Holdsworth M., Cutler SR., Rodriguez PL., Márquez JA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation dupeux-2011-2 A thermodynamic switch modulates abscisic acid receptor sensitivity. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dupeux F., Santiago J., Betz K., Twycross J., Park SY., Rodriguez L., Gonzalez-Guzman M., Jensen MR., Krasnogor N., Blackledge M., Holdsworth M., Cutler SR., Rodriguez PL., Márquez JA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation dupeux-2011-4 A thermodynamic switch modulates abscisic acid receptor sensitivity. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Dupeux F., Santiago J., Betz K., Twycross J., Park SY., Rodriguez L., Gonzalez-Guzman M., Jensen MR., Krasnogor N., Blackledge M., Holdsworth M., Cutler SR., Rodriguez PL., Márquez JA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation dupeux-2011-5 A thermodynamic switch modulates abscisic acid receptor sensitivity. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dupeux F., Santiago J., Betz K., Twycross J., Park SY., Rodriguez L., Gonzalez-Guzman M., Jensen MR., Krasnogor N., Blackledge M., Holdsworth M., Cutler SR., Rodriguez PL., Márquez JA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation pyr1_arath Abscisic acid receptor PYR1 PYR1 ABIP6 At4g17870 RCAR11 Protein PYRABACTIN RESISTANCE 1 ABI1-binding protein 6 Regulatory components of ABA receptor 11 T6K21.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQTYKHFIKSCSVEQNFEMRVGCTRDVIVISGLPANTSTERLDILDDERRVTGFSIIGGEHRLTNYKSVTTVHRFEKENRIWTVVLESYVVDMPEGNSEDDTRMFADTVVKLNLQKLATVAEAMARNSGDGSGSQVT p2c16_arath Protein phosphatase 2C 16 HAB1 P2C-HA Protein phosphatase 2C HAB1 AtP2C-HA Protein HYPERSENSITIVE TO ABA 1 F28P22.4 At1g72770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEMTPAVAMTLSLAANTMCESSPVEITQLKNVTDAADLLSDSENQSFCNGGTECTMEDVSELEEVGEQDLLKTLSDTRSGSSNVFDEDDVLSVVEDNSAVISEGLLVVDAGSELSLSNTAMEIDNGRVLATAIIVGESSIEQVPTAEVLIAGVNQDTNTSEVVIRLPDENSNHLVKGRSVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELCKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRKFKTRT pyl1_arath Abscisic acid receptor PYL1 At5g46790 PYL1 RCAR12 PYR1-like protein 1 ABI1-binding protein 6 Regulatory components of ABA receptor 9 MZA15.21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANSESSSSPVNEEENSQRISTLHHQTMPSDLTQDEFTQLSQSIAEFHTYQLGNGRCSSLLAQRIHAPPETVWSVVRRFDRPQIYKHFIKSCNVSEDFEMRVGCTRDVNVISGLPANTSRERLDLLDDDRRVTGFSITGGEHRLRNYKSVTTVHRFEKEEEEERIWTVVLESYVVDVPEGNSEEDTRLFADTVIRLNLQKLASITEAMNRNNNNNNSSQVR pyl8_arath Abscisic acid receptor PYL8 PYL8 ABIP1 RCAR3 PYR1-like protein 8 ABI1-binding protein 1 Regulatory components of ABA receptor 3 MFH8.10 At5g53160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEANGIENLTNPNQEREFIRRHHKHELVDNQCSSTLVKHINAPVHIVWSLVRRFDQPQKYKPFISRCVVKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIISLHPETIEGRIGTLVIESFVVDVPEGNTKDETCYFVEALIKCNLKSLADISERLAVQDTTESRV pyl6_arath Abscisic acid receptor PYL6 T3G21 At2g40330 PYL6 ABIP5 RCAR9 PYR1-like protein 6 ABI1-binding protein 5 Regulatory components of ABA receptor 9 T7M7.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPTSIQFQRSSTAAEAANATVRNYPHHHQKQVQKVSLTRGMADVPEHVELSHTHVVGPSQCFSVVVQDVEAPVSTVWSILSRFEHPQAYKHFVKSCHVVIGDGREVGSVREVRVVSGLPAAFSLERLEIMDDDRHVISFSVVGGDHRLMNYKSVTTVHESEEDSDGKKRTRVVESYVVDVPAGNDKEETCSFADTIVRCNLQSLAKLAENTSKFS pyl5_arath Abscisic acid receptor PYL5 At5g05440 PYL5 ABIP3 RCAR8 PYR1-like protein 5 ABI1-binding protein 3 Regulatory components of ABA receptor 8 K18I23.25 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRSPVQLQHGSDATNGFHTLQPHDQTDGPIKRVCLTRGMHVPEHVAMHHTHDVGPDQCCSSVVQMIHAPPESVWALVRRFDNPKVYKNFIRQCRIVQGDGLHVGDLREVMVVSGLPAVSSTERLEILDEERHVISFSVVGGDHRLKNYRSVTTLHASDDEGTVVVESYIVDVPPGNTEEETLSFVDTIVRCNLQSLARSTNRQ pyr1-4 1251850 pyr1 Pyr1 1251855 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f2 mint hab1-pyr1-1 1251850 hab1 HAB1 1251856 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pyr1 Pyr1 1251855 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint f2 hab1-pyl1 1251850 pyl1 Pyl1 1251857 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified hab1 HAB1 1251856 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false sf1 mint pyl1-1 1251850 pyl1 Pyl1 1251857 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false sf1 mint hab1-pyl8-2 1251850 hab1 HAB1 1251856 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pyl8 Pyl8 1251858 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false sf1 mint hab1-pyl6-2 1251850 hab1 HAB1 1251856 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pyl6 Pyl6 1251859 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false sf1 mint hab1-pyl5-4 1251850 hab1 HAB1 1251856 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pyl5 Pyl5 1251860 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f2 mint pyr1-4 1251851 pyr1 Pyr1 1251855 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false 1251851 mint t1 pyr1-4 1251851 pyr1 Pyr1 1251855 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified O49686:p.His60Pro mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false 1251851 f3c mint hab1-pyr1-2 1251852 pyr1 Pyr1 1251855 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified hab1 HAB1 1251856 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false t2 f5 mint pyr1-4 1251853 pyr1 Pyr1 1251855 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false sf2a mint pyr1-hab1-4 1251854 pyr1 Pyr1 1251855 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O49686:p.His60Pro mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false hab1 HAB1 1251856 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a mint