MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kokkola-2011-1 Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. yeast Saccharomyces cerevisiae Baker's yeast reverse rrs reverse ras recruitment system reverse RRS reverse rrs predetermined predetermined participant predetermined Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation kokkola-2011-2 Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation kokkola-2011-3 Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down predetermined predetermined participant predetermined Kokkola T., Kruse C., Roy-Pogodzik EM., Pekkinen J., Bauch C., Hönck HH., Hennemann H., Kreienkamp HJ. FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation zdhc5_mouse Palmitoyltransferase ZDHHC5 Zdhhc5 Kiaa1748 Zinc finger DHHC domain-containing protein 5 protein protein mouse Mus musculus Mouse MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLNVSPAVPIYNAIMFLFVLANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSLEITESQSADAEPPPPPKPDLSRYTGLRTHLSLATNEDSSLLGKDSPPTPTMYKYRPGYSSSSTSAAMPHSSSAKLSRGDSLKEPTSIADSSRHPSYRSEPSLEPESFRSPTFGKSFHFDPLSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSPDFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLLPTGPPHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLAGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLSKTPLGRPAVPRFGKPDGLRSRGLGSPEPGTTAPYLGRSISYSSQKAPSGVSETEEVALQPLLTPKDEVQLKTTYSKSNGQPKSIGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV mint ssr5_rat Somatostatin receptor type 5 Sstr5 protein protein rat Rattus norvegicus (Rat) Rat MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIYVVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVVSYWPFGSFLCRLVMTLDGINQFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRRRSEPKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKVLCLRRGYGMEDADAIEPRPDKSGRPQATLPTRSCEANGLMQTSRI mint Receptor for somatostatin-28. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase ssr5_mouse Somatostatin receptor type 5 Sstr5 Smstr5 protein protein mouse Mus musculus Mouse MEPLSLTSTPSWNASAASSSSHNWSLVDPVSPMGARAVLVPVLYLLVCTVGLGGNTLVIYVVLRYAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVSYWPFGSFLCRLVMTLDGINQFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKLASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRRRSERKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKALCLRRGYGVEDADAIEPRPDKSGRPQTTLPTRSCEANGLMQTSRL mint Receptor for somatostatin-28. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase sstr5-zdhhc5 1168371 zdhc5_mouse ZDHHC5 1168374 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cdna library cdna library fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ssr5_rat SSTR5 1168375 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false helix 8 region fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1b homomint mint sstr5-zdhhc5-1 1168372 zdhc5_mouse ZDHHC5 1168374 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ssr5_mouse SSTR5 1168376 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f2 homomint mint sstr5-zdhhc5-2 1168373 zdhc5_mouse ZDHHC5 1168374 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false TM1-TM2 gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ssr5_mouse SSTR5 1168376 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1c f1d homomint mint