MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ma-2011c-1 Anti-HIV siamycin I directly inhibits autophosphorylation activity of the bacterial FsrC quorum sensor and other ATP-dependent enzyme activities. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Ma P., Nishiguchi K., Yuille HM., Davis LM., Nakayama J., Phillips-Jones MK. FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation f0pgm9_entf6 fsrC EF62_2190 protein protein entf6 Enterococcus faecalis (strain 62) MLENSRIFFGCLLLLLILLLLFVFLISPEISPDFMRGFVTVNSSKLELLISVGLFLILIGLVIEAYLEEQRINTQLLNNLTIYTEKIESINEELAMFRHDYKNLLYSLQIAISYEDILEIKRIYEETIAPTKKIIDNEEFELMKLNRLKNMELKALISMKINTAKQAKLKVIVDVPEVFILDTSIDLVVVIRLLAILLDNAIENSAKSELKMFAISIFNKNETQEFVITNSVQAEFDFRVMKKTKFSSKSNPEEHGWGLLYVKEIVDFSDQFDLQTSFNEGSVTQHLIIEKNHNSKKVVNE The sequence has been withdrawn from uniprot. mint regb_cers4 Sensor histidine kinase RegB regB prrB RHOS4_00950 RSP_1520 Protein PrrB protein protein rhos4 Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) MILGPDGILNRDTRGDWVRLRTLILLRWMAVAGQLAAIVVTDWYLGVRLPMGLCFMAVGASVIANVIATFVFPQNRRLTEFQALMILLFDLTQLSFLLFLTGGLTNPFALLILAPVTISALALELRTTVILGAIAIGLLTFTAYFHLPLILADGSSLSVPRMFEFGFWLAIVIGILFLGLYSRRVAIEIRSMSDALLATQMALDREQKLTDLGGVVAAAAHELGTPLATIKLVSSELAEELSEQPALRDDAELIREQADRCRDILRSMGRAGKDDLQMRQAPLGEVLREAAEPHVGRGKRVEFDLYPSRGGDERQPVILRRPEVIHGLRNLIQNAVDFARSTVWIDGEWTGDRIAIRIVDDGEGYPPAIIGRIGDPFVRQRRAEESQSRRPGYEGMGLGLFIAKTLLERSGAELSFANAADPFLRSHERPERCGAIVEVIWPVDRLVVVRNAPLGENVLIQT mint Member of the two-component regulatory system regB/regA. Involved in the positive regulation of photosynthesis gene expression in response to anaerobiosis. Also involved in positive regulation of the cbbI and cbbII Calvin cycle CO2 fixation operons, as well as in regulation of expression of genes involved in alternative CO2 fixation pathways. Phosphorylates regA/prrA fsrc 1168576 f0pgm9_entf6 FsrC 1168577 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra self self self self purified purified phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false resulting-ptm phosphorylation phosphorylation reaction phosphorylation false true false mint f1 f2 true regb 1168576 regb_rhos4 PrrB 1168578 predetermined predetermined participant predetermined self self self self purified purified phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false resulting-ptm phosphorylation phosphorylation reaction phosphorylation false true false f3d mint true