IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ vernoux-2011-1 The auxin signalling network translates dynamic input into robust patterning at the shoot apex yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr Mol. Syst. Biol. 2011 Only protein-protein interactions imex curation vernoux-2011-2 The auxin signalling network translates dynamic input into robust patterning at the shoot apex nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr Mol. Syst. Biol. 2011 Only protein-protein interactions imex curation vernoux-2011-3 The auxin signalling network translates dynamic input into robust patterning at the shoot apex in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr Mol. Syst. Biol. 2011 Only protein-protein interactions imex curation iaa31_arath Auxin-responsive protein IAA31 IAA31 Indoleacetic acid-induced protein 31 MKP6.16 At3g17600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVSNSCSSFSSSSVDSTKPSPSESSVNLSLSLTFPSTSPQREARQDWPPIKSRLRDTLKGRRLLRRGDDTSLFVKVYMEGVPIGRKLDLCVFSGYESLLENLSHMFDTSIICGNRDRKHHVLTYEDKDGDWMMVGDIPWDMFLETVRRLKITRPERY arfa_arath Auxin response factor 1 ARF1 F23H11.7 At1g59750 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASNHSSGKPGGVLSDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQPPQRNKRPRPPGLPSPATGPSGPVTPDGVWKSPADTPSSVPLFSPPAKAATFGHGGNKSFGVSIGSAFWPTNADSAAESFASAFNNESTEKKQTNGNVCRLFGFELVENVNVDECFSAASVSGAVAVDQPVPSNEFDSGQQSEPLNINQSDIPSGSGDPEKSSLRSPQESQSRQIRSCTKVHMQGSAVGRAIDLTRSECYEDLFKKLEEMFDIKGELLESTKKWQVVYTDDEDDMMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKLAVNARMQLKADAEENGNTEGRSSSMAGSR arfl_arath Auxin response factor 12 ARF12 F23M19.4 At1g34310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGNVVNAQPELSGIIDGSKSYVYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVETSTREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAEITLMPDTTQVVIPTQNENQFRPLVNSFTKVLTASDTSAHGGFFVPKKHAIECLPSLDMSQPLPAQELLAIDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVVASAKHAFDNQCMFTVVYKPRSSKFIVSYDKFLDAVNNKFNVGSRFTMRLEGDDFSERRCFGTIIGVSDFSPHWKCSEWRSLEVQWDEFTSFPGPKKVSPWDIEHLMPAINVPRSFLLKNKRLREVNEIGSSSSHLLPPILTQGQENEQLSVASPMNISLRYRDATEDAMNPSKLLMSYPVQPMPKLNYNNQMVTEMEENITTKTGTNFRLFGVTLDTPPVIKDPIEEIGSEISKLTEGKKFGLSQTLRSPTEIQNKQFSSSRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDIKGQLQTRNQWEIAFTDSDEDKMLVGDDPWPEFCNMVKKIFIQKRR arfb_arath Auxin response factor 2 ARF2 ARF1-binding protein MTG10.3 At5g62000 MNT Protein MEGAINTEGUMENTA protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSEVSMKGNRGGDNFSSSGFSDPKETRNVSVAGEGQKSNSTRSAAAERALDPEAALYRELWHACAGPLVTVPRQDDRVFYFPQGHIEQVEASTNQAAEQQMPLYDLPSKLLCRVINVDLKAEADTDEVYAQITLLPEANQDENAIEKEAPLPPPPRFQVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEESDPTRWPKSKWRSLKVRWDETSSIPRPDRVSPWKVEPALAPPALSPVPMPRPKRPRSNIAPSSPDSSMLTREGTTKANMDPLPASGLSRVLQGQEYSTLRTKHTESVECDAPENSVVWQSSADDDKVDVVSGSRRYGSENWMSSARHEPTYTDLLSGFGTNIDPSHGQRIPFYDHSSSPSMPAKRILSDSEGKFDYLANQWQMIHSGLSLKLHESPKVPAATDASLQGRCNVKYSEYPVLNGLSTENAGGNWPIRPRALNYYEEVVNAQAQAQAREQVTKQPFTIQEETAKSREGNCRLFGIPLTNNMNGTDSTMSQRNNLNDAAGLTQIASPKVQDLSDQSKGSKSTNDHREQGRPFQTNNPHPKDAQTKTNSSRSCTKVHKQGIALGRSVDLSKFQNYEELVAELDRLFEFNGELMAPKKDWLIVYTDEENDMMLVGDDPWQEFCCMVRKIFIYTKEEVRKMNPGTLSCRSEEEAVVGEGSDAKDAKSASNPSLSSAGNS iaa10_arath Auxin-responsive protein IAA10 IAA10 Indoleacetic acid-induced protein 10 F20D22.13 At1g04100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNGLQEVCSSSGSVMIGLPAEEDENAAHSSEDSSCPDESVSETELDLALGLSIGRRKVRSSLSSSSSSLTRESGTKRSADSSPAAASNATRQVAVGWPPLRTYRINSLVNQAKSLATEGGLSSGIQKETTKSVVVAAKNDDACFIKSSRTSMLVKVTMDGVIIGRKVDLNALDSYAALEKTLDLMFFQIPSPVTRSNTQGYKTIKETCTSKLLDGSSEYIITYQDKDGDWMLVGDVPWQMFLGSVTRLRIMKTSIGAGVGK iaa32_arath Auxin-responsive protein IAA32 IAA32 Indoleacetic acid-induced protein 32 F10A8.8 At2g01200 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPNTPADFFKGSSKFHTYYSQTKKGGGVIDLGLSLRTIQHETYLPPARMIGLDGYGELIDWSQPSYNSITQLKSEDTGHQRLAQGYYNNEGESRGKYAYVKVNLDGLVVGRKVCLVDQGAYATLALQLNDMFGMQTVSGLRLFQTESEFSLVYRDREGIWRNVGDVPWKEFVESVDRMRIARRNDALLPF iaa34_arath Auxin-responsive protein IAA34 IAA34 Indoleacetic acid-induced protein 34 T15D22.10 At1g15050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYCSDPPHPLHLVASDKQQKDHKLILSWKKPTMDSDPLGVFPNSPKYHPYYSQTTEFGGVIDLGLSLRTIQHEIYHSSGQRYCSNEGYRRKWGYVKVTMDGLVVGRKVCVLDHGSYSTLAHQLEDMFGMQSVSGLRLFQMESEFCLVYRDEEGLWRNAGDVPWNEFIESVERLRITRRNDAVLPF arfc_arath Auxin response factor 3 ARF3 ETT Protein ETTIN T1B8.30 At2g33860 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGGLIDLNVMETEEDETQTQTPSSASGSVSPTSSSSASVSVVSSNSAGGGVCLELWHACAGPLISLPKRGSLVLYFPQGHLEQAPDFSAAIYGLPPHVFCRILDVKLHAETTTDEVYAQVSLLPESEDIERKVREGIIDVDGGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGDDGKLRLGVRRASQIEGTAALSAQYNQNMNHNNFSEVAHAISTHSVFSISYNPKASWSNFIIPAPKFLKVVDYPFCIGMRFKARVESEDASERRSPGIISGISDLDPIRWPGSKWRCLLVRWDDIVANGHQQRVSPWEIEPSGSISNSGSFVTTGPKRSRIGFSSGKPDIPVSEGIRATDFEESLRFQRVLQGQEIFPGFINTCSDGGAGARRGRFKGTEFGDSYGFHKVLQGQETVPAYSITDHRQQHGLSQRNIWCGPFQNFSTRILPPSVSSSPSSVLLTNSNSPNGRLEDHHGGSGRCRLFGFPLTDETTAVASATAVPCVEGNSMKGASAVQSNHHHSQGRDIYAMRDMLLDIAL iaa9_arath Auxin-responsive protein IAA9 Indoleacetic acid-induced protein 9 IAA9 At5g65670 F6H11.210 MPA24.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPEEELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMFPEAAATQSVTKKDVPQNIPKGQSSTTNNSSSPPAAKAQIVGWPPVRSYRKNTLATTCKNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMRA arfd_arath Auxin response factor 4 ARF4 MUF9.8 At5g60450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEFDLNTEIAEVEEEENDDVGVGVGGGTRIDKGRLGISPSSSSSCSSGSSSSSSSTGSASSIYSELWHACAGPLTCLPKKGNVVVYFPQGHLEQDAMVSYSSPLEIPKFDLNPQIVCRVVNVQLLANKDTDEVYTQVTLLPLQEFSMLNGEGKEVKELGGEEERNGSSSVKRTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFAPLDYKQQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRDEGGELRLGIRRAARPRNGLPDSIIEKNSCSNILSLVANAVSTKSMFHVFYSPRATHAEFVIPYEKYITSIRSPVCIGTRFRMRFEMDDSPERRCAGVVTGVCDLDPYRWPNSKWRCLLVRWDESFVSDHQERVSPWEIDPSVSLPHLSIQSSPRPKRPWAGLLDTTPPGNPITKRGGFLDFEESVRPSKVLQGQENIGSASPSQGFDVMNRRILDFAMQSHANPVLVSSRVKDRFGEFVDATGVNPACSGVMDLDRFPRVLQGQEICSLKSFPQFAGFSPAAAPNPFAYQANKSSYYPLALHGIRSTHVPYQNPYNAGNQSSGPPSRAINFGEETRKFDAQNEGGLPNNVTADLPFKIDMMGKQKGSELNMNASSGCKLFGFSLPVETPASKPQSSSKRICTKVHKQGSQVGRAIDLSRLNGYDDLLMELERLFNMEGLLRDPEKGWRILYTDSENDMMVVGDDPWHDFCNVVWKIHLYTKEEVENANDDNKSCLEQAALMMEASKSSSVSQPDSSPTITRV iaa5_arath Auxin-responsive protein IAA5 IAA5 AUX2-27 Auxin-induced protein AUX2-27 Indoleacetic acid-induced protein 5 T16N11.9 At1g15580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANESNNLGLEITELRLGLPGDIVVSGESISGKKRASPEVEIDLKCEPAKKSQVVGWPPVCSYRRKNSLERTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILFGCYINFDDTLKESECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRSCNRG iaa7_arath Auxin-responsive protein IAA7 Indoleacetic acid-induced protein 7 Auxin resistant 2 IAA7 AXR2 At3g23050 MXC7.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS iaa17_arath Auxin-responsive protein IAA17 Indoleacetic acid-induced protein 17 Auxin response 3 IAA17 AXR3 At1g04250 F19P19.31 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA iaa1_arath Auxin-responsive protein IAA1 Indoleacetic acid-induced protein 1 IAA1 At4g14560 dl3320w FCAALL.409 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVTNGLNLKDTELRLGLPGAQEEQQLELSCVRSNNKRKNNDSTEESAPPPAKTQIVGWPPVRSNRKNNNNKNVSYVKVSMDGAPYLRKIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCQKLRIMKGSEAPTAL arfe_arath Auxin response factor 5 Transcription factor MONOPTEROS Auxin-responsive protein IAA24 ARF5 IAA24 MP At1g19850 F6F9.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMASLSCVEDKMKTSCLVNGGGTITTTTSQSTLLEEMKLLKDQSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLAAAAHATANRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRPHNNQNVPSFMSEMQQNIVMGNGGLLGDMKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSGCSSGRVQHGLEQSMEQASQVTTSTVCNEEKVNQLLQKPGASSPVQADQCLDITHQIYQPQSDPINGFSFLETDELTSQVSSFQSLAGSYKQPFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYASQNICMSNSTTSNILDPPLSNTVLDDFCAIKDTDFQNHPSGCLVGNNNTSFAQDVQSQITSASFADSQAFSRQDFPDNSGGTGTSSSNVDFDDCSLRQNSKGSSWQKIATPRVRTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGINDLKTSVS iaa2_arath Auxin-responsive protein IAA2 Indoleacetic acid-induced protein 2 IAA2 At3g23030 MXC7.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAYEKVNELNLKDTELCLGLPGRTEKIKEEQEVSCVKSNNKRLFEETRDEEESTPPTKTQIVGWPPVRSSRKNNNSVSYVKVSMDGAPYLRKIDLKTYKNYPELLKALENMFKVMIGEYCEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCKRLRIMKGSDAPALDSSL iaa3_arath Auxin-responsive protein IAA3 IAA3 SHY2 At1g04240 F19P19.32 Indoleacetic acid-induced protein 3 Short hypocotyl Suppressor of HY2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEFVNLKETELRLGLPGTDNVCEAKERVSCCNNNNKRVLSTDTEKEIESSSRKTETSPPRKAQIVGWPPVRSYRKNNIQSKKNESEHEGQGIYVKVSMDGAPYLRKIDLSCYKGYSELLKALEVMFKFSVGEYFERDGYKGSDFVPTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGLGCGV iaa4_arath Auxin-responsive protein IAA4 Indoleacetic acid-induced protein 4 Auxin-induced protein AUX2-11 IAA4 AUX2-11 At5g43700 MQD19.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKVDVYDELVNLKATELRLGLPGTEETVSCGKSNKRVLPEATEKEIESTGKTETASPPKAQIVGWPPVRSYRKNNVQTKKSESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKFSVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLGCGGL iaa8_arath Auxin-responsive protein IAA8 Indoleacetic acid-induced protein 8 IAA8 At2g22670 T9I22.11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSYRLLSVDKDELVTSPCLKERNYLGLSDCSSVDSSTIPNVVGKSNLNFKATELRLGLPESQSPERETDFGLLSPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFSGVKGSVRPGGGINMMLSPKVKDVSKSIQEERSHAKGGLNNAPAAKAQVVGWPPIRSYRKNTMASSTSKNTDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNKERV iaa11_arath Auxin-responsive protein IAA11 IAA11 Indoleacetic acid-induced protein 11 T5F17.90 At4g28640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGGSASGSASALSNDENLVVSCEDSSSPIGNELELGLTLSLGRKGYRDCRVYADDSSSSSSSSSLSRASVIAGIKRTADSMAATSGQVVGWPPIRTYRMNSMVNQAKASATEDPNLEISQAVNKNRSDSTKMRNSMFVKVTMDGIPIGRKIDLNAHKCYESLSNTLEEMFLKPKLGSRTLETDGHMETPVKILPDGSSGLVLTYEDKEGDWMLVGDVPWGMFIGSVRRLRIMKTSEATGKAQMIL iaa12_arath Auxin-responsive protein IAA12 Indoleacetic acid-induced protein 12 Protein BODENLOS IAA12 BDL At1g04550 T1G11.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGVSELEVGKSNLPAESELELGLGLSLGGGAWKERGRILTAKDFPSVGSKRSAESSSHQGASPPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPKVQGLGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGSSDFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPRRQEQKDRQRNNPV iaa13_arath Auxin-responsive protein IAA13 Indoleacetic acid-induced protein 13 IAA13 F4P9.8 At2g33310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MITELEMGKGESELELGLGLSLGGGTAAKIGKSGGGGAWGERGRLLTAKDFPSVGSKRAADSASHAGSSPPRSSSQVVGWPPIGSHRMNSLVNNQATKSAREEEEAGKKKVKDDEPKDVTKKVNGKVQVGFIKVNMDGVAIGRKVDLNAHSSYENLAQTLEDMFFRTNPGTVGLTSQFTKPLRLLDGSSEFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRVMKTSEANGLAARNQEPNERQRKQPV iaa14_arath Auxin-responsive protein IAA14 IAA14 SLR1 Indoleacetic acid-induced protein 14 Protein SOLITARY ROOT dl3315c FCAALL.254 At4g14550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS iaa15_arath Auxin-responsive protein IAA15 IAA15 Indoleacetic acid-induced protein 15 F5I6.14 At1g80390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPEEYVRVWPDSGDLGGTELTLALPGTPTNASEGPKKFGNKRRFLETVDLKLGEAHENNYISSMVTNDQLVGWPPVATARKTVRRKYVKVALDGAAYLRKVDLGMYDCYGQLFTALENMFQGIITICRVTELERKGEFVATYEDKDGDLMLVGDVPWMMFVESCKRMRLMKTGDAIGL iaa16_arath Auxin-responsive protein IAA16 Indoleacetic acid-induced protein 16 IAA16 At3g04730 F7O18.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MINFEATELRLGLPGGNHGGEMAGKNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS iaa18_arath Auxin-responsive protein IAA18 IAA18 Indoleacetic acid-induced protein 18 T14L22.14 At1g51950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGYSRNGEISPKLLDLMIPQERRNWFHDEKNSVFKTEEKKLELKLGPPGEEDDDESMIRHMKKEPKDKSILSLAGKYFSPSSTKTTSHKRTAPGPVVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAAKTTEPKRQGGMFVKINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNGEYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEISSALTYGNGKQEKMRR iaa19_arath Auxin-responsive protein IAA19 Indoleacetic acid-induced protein 19 Protein MASSUGU 2 IAA19 MSG2 At3g15540 MJK13.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKEGLGLEITELRLGLPGRDVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGDAEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSSQGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRLRIMKRSDATGFGLQPRGVDE iaa20_arath Auxin-responsive protein IAA20 Indoleacetic acid-induced protein 20 IAA20 At2g46990 F14M4.18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRSSSSSSIESSSKSNPFGASSSTRNLSTDLRLGLSFGTSSGTQYFNGGYGYSVAAPAVEDAEYVAAVEEEEENECNSVGSFYVKVNMEGVPIGRKIDLMSLNGYRDLIRTLDFMFNASILWAEEEDMCNEKSHVLTYADKEGDWMMVGDVPWEMFLSTVRRLKISRANYHY iaa27_arath Auxin-responsive protein IAA27 IAA27 PAP2 Auxin-induced protein 27 Indoleacetic acid-induced protein 27 Phytochrome-associated protein 2 F19B15.110 At4g29080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVSVAAEHDYIGLSEFPTMEATTMSDKTKTRDNNNGLNFKATELRLGLPGSESPERVDSRFLALNKSSCPVSGAKRVFSDAINDSNKWVFSPGSTTATGDVGSGSGPRTSVVKDGKSTTFTKPAVPVKEKKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKVSMEGAPYLRKIDLKTYKSYLELSSALEKMFSCFTIGQFGSHGGCGRDGLNESRLTDLLRGSEYVVTYEDKDSDWMLVGDVPWEMFICSCKKLRIMKSSEAIGLAPRVMEKCRSRN iaa28_arath Auxin-responsive protein IAA28 IAA28 Indoleacetic acid-induced protein 28 T1N24.24 F18A17.6 At5g25890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEEKRLELRLAPPCHQFTSNNNINGSKQKSSTKETSFLSNNRVEVAPVVGWPPVRSSRRNLTAQLKEEMKKKESDEEKELYVKINMEGVPIGRKVNLSAYNNYQQLSHAVDQLFSKKDSWDLNRQYTLVYEDTEGDKVLVGDVPWEMFVSTVKRLHVLKTSHAFSLSPRKHGKE iaa29_arath Auxin-responsive protein IAA29 IAA29 Indoleacetic acid-induced protein 29 F10M6.80 At4g32280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MELDLGLSLSPHKSSKLGFNFDLNKHCAIEGAASCLGTEKLRFEATFGLGNVEENCYMPKQRLFALNGQPNEEDEDPLESESSIVYDDEEENSEVVGWPPVKTCMIKYGSYHHRHIRNHHHCPYHHRGRRITAMNNNISNPTTATVGSSSSSSISSRSSMYVKVKMDGVAIARKVDIKLFNSYESLTNSLITMFTEYEDCDREDTNYTFTFQGKEGDWLLRGDVTWKIFAESVHRISIIRDRPCAYTRCLF iaa30_arath Auxin-responsive protein IAA30 IAA30 Indoleacetic acid-induced protein 30 T17J13.60 At3g62100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRSSSSSSIESSCKSNPFGVSSSNTRNLSTDLRLGLSFGSSSGQYYNGGDNHEYDGVGAAEEMMIMEEEEQNECNSVGSFYVKVNMEGVPIGRKIDLLSLNGYHDLITTLDYMFNASILWAEEEDMCSEKSHVLTYADKEGDWMMVGDVPWEMFLSSVRRLKISRAYHY iaa33_arath Auxin-responsive protein IAA33 IAA33 Indoleacetic acid-induced protein 33 MUA2.1 At5g57420 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSFEPQSQDSLQRRFHQDNSTTQQPRDTTTPFIPKPASKNHNNSNSSSGAAGRSFQGFGLNVEDDLVSSVVPPVTVVLEGRSICQRISLDKHGSYQSLASALRQMFVDGADSTDDLDLSNAIPGHLIAYEDMENDLLLAGDLTWKDFVRVAKRIRILPVKGNTRQVKRNE arfi_arath Auxin response factor 9 ARF9 T19F6.20 T32A16.150 At4g23980 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANRGGEYLYDELWKLCAGPLVDVPQAQERVYYFPQGHMEQLEASTQQVDLNTMKPLFVLPPKILCNVMNVSLQAEKDTDEVYAQITLIPVGTEVDEPMSPDPSPPELQRPKVHSFSKVLTASDTSTHGGFSVLRKHATECLPPLDMTQQTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELRVGVRRANLQQSSMPSSVISSHSMHLGVLATARHATQTKTMFIVYYKPRTSQFIISLNKYLEAMSNKFSVGMRFKMRFEGEDSPERRYSGTVIGVKDCSPHWKDSKWRCLEVHWDEPASISRPNKVSPWEIEPFVNSENVPKSVMLKNKRPRQVSEVSALDVGITASNLWSSVLTQPHEFAQSCITSQWSSPQQCHRDANEDAKKSDWLNNSYSVSNVAKDSTLNDQMVSPVEQKKPETTANYRLFGIDLMSSSLAVPEEKTAPMRPINISKPTMDSHSDPKSEISKVSEEKKQEPAEGSPKEVQSKQSSSTRSRTKVQMQGVPVGRAVDLNALKGYNELIDDIEKLFDIKGELRSRNQWEIVFTDDEGDMMLVGDDPWPEFCNMVKRIFIWSKEEVKKMTPGNQLRMLLREVETTLTTTSKTDNHSN arff_arath Auxin response factor 6 ARF6 T4K22.6 At1g30330 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKDPYLPAELGVPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPSSVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMWDRGLQSLNFQGMGVNPWMQPRLDTSGLLGMQNDVYQAMAAAALQDMRGIDPAKAAASLLQFQNSPGFSMQSPSLVQPQMLQQQLSQQQQQLSQQQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQAYLGVPETHQPQSQAQSQSNNHLSQQQQQVVDNHNPSASSAAVVSAMSQFGSASQPNTSPLQSMTSLCHQQSFSDTNGGNNPISPLHTLLSNFSQDESSQLLHLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNNTQSVLEQLGQSHTSNVPPNAVSLPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNNDFSGNLAMTTPSSCIDESGFLQSSENLGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKRGLELLNSAPSSNNVDKLPSNGNCDDFGNRSDPRNLGNGIASVGGSFNY arfr_arath Auxin response factor 18 ARF18 F15G16.220 At3g61830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASVEGDDDFGSSSSRSYQDQLYTELWKVCAGPLVEVPRAQERVFYFPQGHMEQLVASTNQGINSEEIPVFDLPPKILCRVLDVTLKAEHETDEVYAQITLQPEEDQSEPTSLDPPIVGPTKQEFHSFVKILTASDTSTHGGFSVLRKHATECLPSLDMTQATPTQELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFLRGENGDLRVGVRRLARHQSTMPTSVISSQSMHLGVLATASHAVRTTTIFVVFYKPRISQFIVGVNKYMEAIKHGFSLGTRFRMRFEGEESPERIFTGTIVGSGDLSSQWPASKWRSLQVQWDEPTTVQRPDKVSPWEIEPFLATSPISTPAQQPQSKCKRSRPIEPSVKTPAPPSFLYSLPQSQDSINASLKLFQDPSLERISGGYSSNNSFKPETPPPPTNCSYRLFGFDLTSNSPAPIPQDKQPMDTCGAAKCQEPITPTSMSEQKKQQTSRSRTKVQMQGIAVGRAVDLTLLKSYDELIDELEEMFEIQGQLLARDKWIVVFTDDEGDMMLAGDDPWNEFCKMAKKIFIYSSDEVKKMTTKLKISSSLENEEYGNESFENRSRG arft_arath Auxin response factor 20 ARF20 T9I1.3 At1g35240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METGNVVNAQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGENVYYFPQGNIELVDASTREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAEITLMPDTTQVVIPTQSENQFRPLVNSFTKVLTASDTSAYGGFFVPKKHAIECLPPLPLPAQELLAKDLHGNQWRFRHSYRGTPQRHSLTTGWNEFTTSKKLVKGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVIASAKHALDNQCIFIVVYKPSIRSSQFIVSYDKFLDAMNNKFIVGSRFTMRFEGDDFSERRYFGTIIGVNDFSPHWKCSEWRSLEVQWDEFASFSRPNKVSPWEIEHLMSALNVPRSSLLKNKRLREVNEFGQEIGQLSVASPMNTSLRYRDTTEDAMNPSRLLMSYPVQPMPKLNYNNQMVTQIEENITTKAVTNFRLFGVSLAIPLVIKDPIEEIGSDISKLTEGKKFGQSQTLRSPIEIQSKQFGSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRNQWKIAFTDSDGYEMLVGDDPWPEFCKMVKKILIYSKEEVKNLKSSKSLSS arfg_arath Auxin response factor 7 Auxin-responsive protein IAA21/IAA23/IAA25 TIR5 Protein BIPOSTO ARF7 BIP IAA21 IAA23 IAA25 NPH4 At5g20730 T1M15.130 Protein NON-PHOTOTROPIC HYPOCOTYL 4 Protein TRANSPORT INHIBITOR RESPONSE 5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKAPSSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPALSSSVISSDSMHIGVLAAAAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEPVLTPFYICPPPFFRPRFSGQPGMPDDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLSLVQWMNMQQQNGQLPSAAAQPGFFPSMLSPTAALHNNLGGTDDPSKLLSFQTPHGGISSSNLQFNKQNQQAPMSQLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQQQQQQLLQQQQQLQSQQHSNNNQSQSQQQQQLLQQQQQQQLQQQHQQPLQQQTQQQQLRTQPLQSHSHPQPQQLQQHKLQQLQVPQNQLYNGQQAAQQHQSQQASTHHLQPQLVSGSMASSVITPPSSSLNQSFQQQQQQSKQLQQAHHHLGASTSQSSVIETSKSSSNLMSAPPQETQFSRQVEQQQPPGLNGQNQQTLLQQKAHQAQAQQIFQQSLLEQPHIQFQLLQRLQQQQQQQFLSPQSQLPHHQLQSQQLQQLPTLSQGHQFPSSCTNNGLSTLQPPQMLVSRPQEKQNPPVGGGVKAYSGITDGGDAPSSSTSPSTNNCQISSSGFLNRSQSGPAILIPDAAIDMSGNLVQDLYSKSDMRLKQELVGQQKSKASLTDHQLEASASGTSYGLDGGENNRQQNFLAPTFGLDGDSRNSLLGGANVDNGFVPDTLLSRGYDSQKDLQNMLSNYGGVTNDIGTEMSTSAVRTQSFGVPNVPAISNDLAVNDAGVLGGGLWPAQTQRMRTYTKVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVGDDPWEEFVNCVQSIKILSSAEVQQMSLDGNFAGVPVTNQACSGGDSGNAWRGHYDDNSATSFNR arfh_arath Auxin response factor 8 ARF8 K15O15.5 At5g37020 FWF Protein FRUIT WITHOUT FERTILIZATION protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLSTSGLGQQGHEGEKCLNSELWHACAGPLVSLPSSGSRVVYFPQGHSEQVAATTNKEVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPEEQKETFVPIELGIPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIRNEKNQLFLGIRHATRPQTIVPSSVLSSDSMHIGLLAAAAHASATNSCFTVFFHPRASQSEFVIQLSKYIKAVFHTRISVGMRFRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLKRPWHAGTSSLPDGRGDLGSGLTWLRGGGGEQQGLLPLNYPSVGLFPWMQQRLDLSQMGTDNNQQYQAMLAAGLQNIGGGDPLRQQFVQLQEPHHQYLQQSASHNSDLMLQQQQQQQASRHLMHAQTQIMSENLPQQNMRQEVSNQPAGQQQQLQQPDQNAYLNAFKMQNGHLQQWQQQSEMPSPSFMKSDFTDSSNKFATTASPASGDGNLLNFSITGQSVLPEQLTTEGWSPKASNTFSEPLSLPQAYPGKSLALEPGNPQNPSLFGVDPDSGLFLPSTVPRFASSSGDAEASPMSLTDSGFQNSLYSCMQDTTHELLHGAGQINSSNQTKNFVKVYKSGSVGRSLDISRFSSYHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPEDVHQMGDHGEGSGGLFPQNPTHL iaa26_arath Auxin-responsive protein IAA26 IAA26 PAP1 Indoleacetic acid-induced protein 26 Phytochrome-associated protein 1 MDC8.13 At3g16500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGCPRNREIGPKLLDLIPQGRKWYQEDKNNTDQEKKLELRLGPPGGDEEDHSAIKKKNTEIRNIKKETEDKSFHCFNGNHFSPSNKTTSVPHISQKRTAPGPVVGWPPVRSFRKNLASTSSSKLGNESSHGGQINKSDDGEKQVETKKEGMFVKINMDGVPIGRKVDLNAYNSYEQLSFVVDKLFRGLLAAQRDISDGQGEEKPIIGLLDGKGEFTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKSSEISSALTFGCSKQEKMMH arfj_arath Auxin response factor 10 ARF10 T1B3.13 At2g28350 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQEKSLDPQLWHACAGSMVQIPSLNSTVFYFAQGHTEHAHAPPDFHAPRVPPLILCRVVSVKFLADAETDEVFAKITLLPLPGNDLDLENDAVLGLTPPSSDGNGNGKEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTVIAKDIHGETWKFRHIYRGTPRRHLLTTGWSTFVNQKKLIAGDSIVFLRSESGDLCVGIRRAKRGGLGSNAGSDNPYPGFSGFLRDDESTTTTSKLMMMKRNGNNDGNAAATGRVRVEAVAEAVARAACGQAFEVVYYPRASTPEFCVKAADVRSAMRIRWCSGMRFKMAFETEDSSRISWFMGTVSAVQVADPIRWPNSPWRLLQVAWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPRKKIRIPQPFEFPFHGTKFPIFSPGFANNGGGESMCYLSNDNNNAPAGIQGARQAQQLFGSPSPSLLSDLNLSSYTGNNKLHSPAMFLSSFNPRHHHYQARDSENSNNISCSLTMGNPAMVQDKKKSVGSVKTHQFVLFGQPILTEQQVMNRKRFLEEEAEAEEEKGLVARGLTWNYSLQGLETGHCKVFMESEDVGRTLDLSVIGSYQELYRKLAEMFHIEERSDLLTHVVYRDANGVIKRIGDEPFSDFMKATKRLTIKMDIGGDNVRKTWITGIRTGENGIDASTKTGPLSIFA arfv_arath Auxin response factor 22 ARF22 F7P12.6 At1g34390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGNIVNAQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGEKIYYFPQGNIELVEASTREELNELKPICDLPSKLQCRVIAIQLKVENNSDETYAEITLMPDTTQVVIPTQNENQFRPLVNSFTKVLTASDTSGGFFVPKKHAIECLPPLDMSQPLPTQELLATDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFVRGETGELRVGIRRAGHQQGNIPSSIISIESMRHGVIASAKHAFDNQCMFIVVYKPRSSQFIVSYDKFLDAVNNKFNVGSRFTMRFEGDDFSERRYFGTIIGVSDFSPHWKCSEWRNLEVQWDEFASFSRPNKVSPWEIEHLMPALNVPRPSLLKNKRLREVNEIGSSSSHLLPPILTQGQEIGQLSVASPMNISLTYRDTTEDVMNPSRLLMSYPVQPMPKLNYNNQMVTQIEENITTKTGTNFRLFGVSLVTPSVIKDPIEEIGSEISKLTEGKKFGQSQTLRSPTEIQSKQFSSTRTCTKVQMQGVTIERAVDLSVLNGYDQLILELEELFDLKGQLQTRNQWEIAFTDSDDDKMLVGDDPWPEFCNMVKKILIFKRGGQKLEVQ arfm_arath Auxin response factor 13 ARF13 F12G12.1 F23M19.15 At1g34170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENNGEMNAQPELSVDITKTYMYEKLWNICAGPLCVLPKPGEKVYYFPQGHIELIENSTRDELDHIRPIFDLPSKLRCRVVAIDRKVDKNTDEVYAQISLMPDTTEVMTHNTTMDTRRPIVYFFSKILTASDVSLSGGLIIPKQYAIECFPPLDMSQPISTQNLVAKDLYGQEWSFKHVFRGTPQRHMFTSGGGWSVFATTKRLIVGDIFVLLRGENGELRFGIRRAKHQQGHIPSSVISANCMQHGVIASVVNAFKTKCMFNVVYKPSSSQFVISYDKFVDAMNNNYIVGSRFRMQFEGKDFSEKRYDGTIIGVNDMSPHWKDSEWRSLKVQWDELSPFLRPNQVSPWDIEHLIPSSDISQSSLKKKKHWLQLNEIGATLSNLWTCQEIGQRSMNSPISVPEFSYPNAIEDSKFLSGLLLNHSLLAIPNENYNSDQMIQPRKEDITTEATTSCLLFGVDLTKVSKSKDSICPIESCKKSLPQDKKFDQTQPLRSPKEVQSTEFNFTRSRIKVHMQGVAISRAVDLTAMHGYNQLIQKLEELFDLKDELRTRNQWEIVFTNNEGAEMLVGDDPWPEFCNMAKRIFICSKEEIKKMKLKNKFFQPESKALTSSDVPPNVTDN arfn_arath Putative auxin response factor 14 ARF14 F15O4.37 At1g35540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGNVVNTQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVEASTREELNELQPICDFPSKLQCRVIAIQLKVENNSDETYAEITLMPDTTQVVIPTQNQNQFRPLVNSFTKVLTASDTSVHGGFSVPKKHAIECLPPLDMSQPLPTQEILAIDLHGNQWRFRHIYRGTAQRHLLTIGWNAFTTSKKLVEGDVIVFVRGETGELRVGIRRAGHQQGNIPSSIVSIESMRHGIIASAKHAFDNQCMFIVVYKPRSSQFIVSYDKFLDVVNNKFNVGSRFTMRFEGDDFSERRSFGTIIGVSDFSPHWKCSEWRSLEVQWDEFASFPRPNQVSPWDIEHLTPWSNVSRSSFLKNKRSREVNEIGSSSSHLLPPTLTQGQEIGQQSMATPMNISLRYRDITEDAMTPSRLLMSYPVQPMAKLNYNNVVTPIEENITTNAVASFRLFGVSLATPSVIKDPVEQIGLEISRLTQEKKFGQSQILRSPTEIQSKQFSSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQARNQWEIAFTNNEEDKMLVGEDPWPEFCNMVKKIFIYSKEEVKNLKSRKSLSS arfp_arath Auxin response factor 16 ARF16 F6G3.110 At4g30080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MINVMNPMKGGTEKGLDPQLWHACAGGMVRMPPMNSKVFYFPQGHAENAYDCVDFGNLPIPPMVLCRVLAIKYMADAESDEVFAKLRLIPLKDDEYVDHEYGDGEDSNGFESNSEKTPSFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYNAEPPVQTILAKDVHGDVWKFRHIYRGTPRRHLLTTGWSNFVNQKKLVAGDSIVFMRAENGDLCVGIRRAKRGGIGNGPEYSAGWNPIGGSCGYSSLLREDESNSLRRSNCSLADRKGKVTAESVIEAATLAISGRPFEVVYYPRASTSEFCVKALDARAAMRIPWCSGMRFKMAFETEDSSRISWFMGTVSAVNVSDPIRWPNSPWRLLQVAWDEPDLLQNVKRVNPWLVELVSNVHPIPLTSFSPPRKKMRLPQHPDYNNLINSIPVPSFPSNPLIRSSPLSSVLDNVPVGLQGARHNAHQYYGLSSSDLHHYYLNRPPPPPPPSSLQLSPSLGLRNIDTKNEKGFCFLTMGTTPCNDTKSKKSHIVLFGKLILPEEQLSEKGSTDTANIEKTQISSGGSNQNGVAGREFSSSDEGSPCSKKVHDASGLETGHCKVFMESDDVGRTLDLSVLGSYEELSRKLSDMFGIKKSEMLSSVLYRDASGAIKYAGNEPFSEFLKTARRLTILTEQGSESVVV arfq_arath Auxin response factor 17 ARF17 F28K19.6 T32E8.16 At1g77850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPPSATAGDINHREVDPTIWRACAGASVQIPVLHSRVYYFPQGHVEHCCPLLSTLPSSTSPVPCIITSIQLLADPVTDEVFAHLILQPMTQQQFTPTNYSRFGRFDGDVDDNNKVTTFAKILTPSDANNGGGFSVPRFCADSVFPLLNFQIDPPVQKLYVTDIHGAVWDFRHIYRGTPRRHLLTTGWSKFVNSKKLIAGDSVVFMRKSADEMFIGVRRTPISSSDGGSSYYGGDEYNGYYSQSSVAKEDDGSPKKTFRRSGNGKLTAEAVTDAINRASQGLPFEVVFYPAAGWSEFVVRAEDVESSMSMYWTPGTRVKMAMETEDSSRITWFQGIVSSTYQETGPWRGSPWKQLQITWDEPEILQNVKRVNPWQVEIAAHATQLHTPFPPAKRLKYPQPGGGFLSGDDGEILYPQSGLSSAAAPDPSPSMFSYSTFPAGMQGARQYDFGSFNPTGFIGGNPPQLFTNNFLSPLPDLGKVSTEMMNFGSPPSDNLSPNSNTTNLSSGNDLVGNRGPLSKKVNSIQLFGKIITVEEHSESGPAESGLCEEDGSKESSDNETQLSLSHAPPSVPKHSNSNAGSSSQG arfs_arath Auxin response factor 19 Auxin-responsive protein IAA22 ARF19 IAA22 At1g19220 T29M8.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKAPSNGFLPSSNEGEKKPINSQLWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKQTDFIPNYPNLPSKLICLLHSVTLHADTETDEVYAQMTLQPVNKYDREALLASDMGLKLNRQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVRDEKSQLMLGIRRANRQTPTLSSSVISSDSMHIGILAAAAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVITPFYICPPPFFRPKYPRQPGMPDDELDMENAFKRAMPWMGEDFGMKDAQSSMFPGLSLVQWMSMQQNNPLSGSATPQLPSALSSFNLPNNFASNDPSKLLNFQSPNLSSANSQFNKPNTVNHISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVANQVSCQSPNQPTGFSQSQLQQQSMLPTGAKMTHQNINSMGNKGLSQMTSFAQEMQFQQQLEMHNSSQLLRNQQEQSSLHSLQQNLSQNPQQLQMQQQSSKPSPSQQLQLQLLQKLQQQQQQQSIPPVSSSLQPQLSALQQTQSHQLQQLLSSQNQQPLAHGNNSFPASTFMQPPQIQVSPQQQGQMSNKNLVAAGRSHSGHTDGEAPSCSTSPSANNTGHDNVSPTNFLSRNQQQGQAASVSASDSVFERASNPVQELYTKTESRISQGMMNMKSAGEHFRFKSAVTDQIDVSTAGTTYCPDVVGPVQQQQTFPLPSFGFDGDCQSHHPRNNLAFPGNLEAVTSDPLYSQKDFQNLVPNYGNTPRDIETELSSAAISSQSFGIPSIPFKPGCSNEVGGINDSGIMNGGGLWPNQTQRMRTYTKVQKRGSVGRSIDVTRYSGYDELRHDLARMFGIEGQLEDPLTSDWKLVYTDHENDILLVGDDPWEEFVNCVQNIKILSSVEVQQMSLDGDLAAIPTTNQACSETDSGNAWKVHYEDTSAAASFNR iaa6_arath Auxin-responsive protein IAA6 Indoleacetic acid-induced protein 6 IAA6 SHY1 F14G24.10 At1g52830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQQD tir1l_arath Transport inhibitor response 1-like protein K9P8.12 At5g49980 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTQDRSEMSEDDDDQQSPPLDLPSTAIADPCSSSSSPNKSRNCISNSQTFPDHVLENVLENVLQFLDSRCDRNAASLVCKSWWRVEALTRSEVFIGNCYALSPARLTQRFKRVRSLVLKGKPRFADFNLMPPDWGANFAPWVSTMAQAYPCLEKVDLKRMFVTDDDLALLADSFPGFKELILVCCEGFGTSGISIVANKCRKLKVLDLIESEVTDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSPFLKKLRLNRFVSLVELHRLLLGAPQLTSLGTGSFSHDEEPQSEQEPDYAAAFRACKSVVCLSGFRELMPEYLPAIFPVCANLTSLNFSYANISPDMFKPIILNCHKLQVFWALDSICDEGLQAVAATCKELRELRIFPFDPREDSEGPVSELGLQAISEGCRKLESILYFCQRMTNAAVIAMSENCPELTVFRLCIMGRHRPDHVTGKPMDEGFGAIVKNCKKLTRLAVSGLLTDQAFRYMGEYGKLVRTLSVAFAGDSDMALRHVLEGCPRLQKLEIRDSPFGDVALRSGMHRYYNMRFVWMSACSLSKGCCKDIARAMPNLVVEVIGSDDDDDNRDYVETLYMYRSLDGPRNDAPKFVTIL tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL grh1_arath GRR1-like protein 1 Protein AUXIN SIGNALING F-BOX 1 GRH1 AFB1 FBL18 GER1 LRF1 F4C21.11 At4g03190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGLRFPPKVLEHILSFIDSNEDRNSVSLVCKSWFETERKTRKRVFVGNCYAVSPAAVTRRFPEMRSLTLKGKPHFADYNLVPDGWGGYAWPWIEAMAAKSSSLEEIRMKRMVVTDECLEKIAASFKDFKVLVLTSCEGFSTDGIAAIAATCRNLRVLELRECIVEDLGGDWLSYFPESSTSLVSLDFSCLDSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLVSLLRCAPQLTELGTGSFAAQLKPEAFSKLSEAFSNCKQLQSLSGLWDVLPEYLPALYSVCPGLTSLNLSYATVRMPDLVELLRRCSKLQKLWVMDLIEDKGLEAVASYCKELRELRVFPSEPDLDATNIPLTEQGLVFVSKGCRKLESVLYFCVQFTNAALFTIARKRPNLKCFRLCVIEPFAPDYKTNEPLDKGFKAIAEGCRDLRRLSVSGLLSDKAFKYIGKHAKKVRMLSIAFAGDSDLMLHHLLSGCESLKKLEIRDCPFGDTALLEHAAKLETMRSLWMSSCFVSFGACKLLSQKMPRLNVEVIDEHPPESRPESSPVERIYIYRTVAGPRMDTPEFVWTIHKNPENGVSHLAIK arf1-iaa31 1155384 iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey arfa_arath ARF1 At1g59750 1155388 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf2-arf12 1155384 arfl_arath ARF12 At1g34310 1155389 unspecified role unspecified role prey prey arfb_arath ARF2 At5g62000 1155390 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf2-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey arfb_arath ARF2 At5g62000 1155390 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf2-iaa32 1155384 arfb_arath ARF2 At5g62000 1155390 unspecified role unspecified role bait bait iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf2-iaa34 1155384 arfb_arath ARF2 At5g62000 1155390 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf3-iaa9 1155384 arfc_arath ARF3 At2g33860 1155394 unspecified role unspecified role bait bait iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf4-iaa5 1155384 arfd_arath ARF4 At5g60450 1155396 unspecified role unspecified role bait bait iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf4-iaa7 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey arfd_arath ARF4 At5g60450 1155396 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf4-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey arfd_arath ARF4 At5g60450 1155396 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf4-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey arfd_arath ARF4 At5g60450 1155396 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa1 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa2 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa3 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa4 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa5 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa7 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa8 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa11 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa12 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa13 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa17 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa19 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa20 1155384 iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa28 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa29 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa31 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa32 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-iaa33 1155384 iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf5-iaa34 1155384 arfe_arath ARF5 At1g19850 1155401 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-arf9 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-arf18 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait arfr_arath ARF18 At3g61830 1155422 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa1 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa2 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-iaa3 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa4 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-iaa7 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa8 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa9 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-iaa10 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa11 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa13 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-iaa15 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa16 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa17 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-iaa20 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-iaa28 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa29 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-iaa31 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf6-iaa33 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf6-iaa34 1155384 arff_arath ARF6 At1g30330 1155421 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-arf20 1155384 arft_arath ARF20 At1g35240 1155423 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa1 1155384 arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-iaa2 1155384 arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-iaa3 1155384 arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-iaa4 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa7 1155384 arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-iaa8 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa11 1155384 arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-iaa12 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa13 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa17 1155384 arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa19 1155384 arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-iaa20 1155384 iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa27 1155384 arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf7-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa29 1155384 iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf7-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey arfg_arath ARF7 At5g20730 1155424 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf8-iaa1 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa2 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa3 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa4 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa7 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa8 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa10 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa12 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa13 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf8-iaa15 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf8-iaa17 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf8-iaa19 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa20 1155384 iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf8-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf8-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf8-iaa29 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa30 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf8-iaa31 1155384 iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf8-iaa32 1155384 arfh_arath ARF8 At5g37020 1155425 unspecified role unspecified role bait bait iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-arf20 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait arft_arath ARF20 At1g35240 1155423 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa1 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role prey prey arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf9-iaa2 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa3 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf9-iaa4 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa10 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa12 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf9-iaa13 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf9-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf9-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf9-iaa26 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa27 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa28 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa29 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa30 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa32 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf9-iaa34 1155384 arfi_arath ARF9 At4g23980 1155420 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf10-iaa5 1155384 arfj_arath ARF10 At2g28350 1155427 unspecified role unspecified role bait bait iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf10-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey arfj_arath ARF10 At2g28350 1155427 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf10-iaa26 1155384 arfj_arath ARF10 At2g28350 1155427 unspecified role unspecified role bait bait iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf10-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey arfj_arath ARF10 At2g28350 1155427 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf10-iaa33 1155384 iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey arfj_arath ARF10 At2g28350 1155427 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf12-arf22 1155384 arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role prey prey arfl_arath ARF12 At1g34310 1155389 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf12-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey arfl_arath ARF12 At1g34310 1155389 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf12-iaa31 1155384 arfl_arath ARF12 At1g34310 1155389 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf13-iaa4 1155384 arfm_arath ARF13 At1g34170 1155429 unspecified role unspecified role bait bait iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf14-iaa5 1155384 arfn_arath ARF14 At1g35540 1155430 unspecified role unspecified role bait bait iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf16-iaa5 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey arfp_arath ARF16 At4g30080 1155431 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf16-iaa26 1155384 iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role prey prey arfp_arath ARF16 At4g30080 1155431 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf16-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey arfp_arath ARF16 At4g30080 1155431 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf16-iaa33 1155384 iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey arfp_arath ARF16 At4g30080 1155431 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf17-iaa1 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role prey prey arfq_arath ARF17 At1g77850 1155432 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf17-iaa29 1155384 iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey arfq_arath ARF17 At1g77850 1155432 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf17-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey arfq_arath ARF17 At1g77850 1155432 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf18-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey arfr_arath ARF18 At3g61830 1155422 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf18-iaa33 1155384 arfr_arath ARF18 At3g61830 1155422 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf18-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey arfr_arath ARF18 At3g61830 1155422 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-arf20 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait arft_arath ARF20 At1g35240 1155423 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa1 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa2 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa3 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa4 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa5 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa7 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa8 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa10 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa12 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa13 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa16 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa17 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa19 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa20 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa29 1155384 iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf19-iaa33 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf19-iaa34 1155384 arfs_arath ARF19 At1g19220 1155433 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf20-iaa5 1155384 arft_arath ARF20 At1g35240 1155423 unspecified role unspecified role bait bait iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf20-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey arft_arath ARF20 At1g35240 1155423 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf20-iaa17 1155384 arft_arath ARF20 At1g35240 1155423 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf20-iaa31 1155384 iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey arft_arath ARF20 At1g35240 1155423 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf20-iaa33 1155384 iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey arft_arath ARF20 At1g35240 1155423 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf22-iaa5 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf22-iaa7 1155384 arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf22-iaa9 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf22-iaa16 1155384 arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf22-iaa20 1155384 arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf22-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf22-iaa28 1155384 arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf22-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait physical association physical association false false false Table S1 arf22-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey arfv_arath ARF22 At1g34390 1155428 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa1 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa2 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa3 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa4 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa5 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa7 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa8 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa9 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa16 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa17 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa19 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa1-iaa31 1155384 iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa1-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa1_arath IAA1 At4g14560 1155400 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa2-iaa2 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role prey prey iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa2-iaa3 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa2-iaa4 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa5 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa8 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa9 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa2-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa2-iaa15 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa16 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa17 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa20 1155384 iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa2-iaa27 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa28 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa2-iaa33 1155384 iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa2-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa2_arath IAA2 At3g23030 1155402 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa3 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa4 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa5 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa8 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa9 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa12 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa13 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa17 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa18 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa19 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa20 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa27 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa3-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa31 1155384 iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa3-iaa34 1155384 iaa3_arath IAA3 At1g04240 1155403 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa4 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa5 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa4-iaa8 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa9 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa10 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa11 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa12 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa13 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa14 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa4-iaa16 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa4-iaa18 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa19 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa20 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa4-iaa28 1155384 iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa4-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa4-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa4_arath IAA4 At5g43700 1155404 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa5 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa7 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa8 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa9 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa12 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa13 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa14 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa16 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa17 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa18 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa19 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa20 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa29 1155384 iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa30 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa31 1155384 iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa5-iaa33 1155384 iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa5-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa5_arath IAA5 At1g15580 1155397 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa6-iaa17 1155384 iaa6_arath IAA6 At1g52830 1155434 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa6-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa6_arath IAA6 At1g52830 1155434 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa6-iaa34 1155384 iaa6_arath IAA6 At1g52830 1155434 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa8 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa7-iaa12 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa13 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa15 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa17 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa18 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa20 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa27 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa28 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa7-iaa32 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa33 1155384 iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa7-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa7_arath IAA7 At3g23050 1155398 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa8-iaa8 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa8-iaa9 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa8-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa8-iaa12 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa8-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa8-iaa15 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa8-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa8-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa8-iaa18 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa8-iaa19 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa8-iaa20 1155384 iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa8-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa8-iaa28 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa8-iaa34 1155384 iaa8_arath IAA8 At2g22670 1155405 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa9-iaa9 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa9-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa11 1155384 iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa12 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa13 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa18 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa9-iaa19 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa26 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa9-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa9-iaa28 1155384 iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa9-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa9_arath IAA9 At5g65670 1155395 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa10-iaa10 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role prey prey iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa10-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa10-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa10-iaa17 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa10-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa10-iaa19 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa10-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa10-iaa28 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa10-iaa30 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa10-iaa31 1155384 iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa10-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa10_arath IAA10 At1g04100 1155391 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa11-iaa16 1155384 iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa11-iaa19 1155384 iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa11-iaa28 1155384 iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa11-iaa30 1155384 iaa11_arath IAA11 At4g28640 1155406 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa12-iaa12 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa12-iaa13 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role prey prey iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa12-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa12-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa12-iaa16 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa12-iaa17 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa12-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa12-iaa19 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa12-iaa20 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa12-iaa28 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa12-iaa30 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa12-iaa31 1155384 iaa12_arath IAA12 At1g04550 1155407 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa13-iaa14 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role prey prey iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa13-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa13-iaa16 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role bait bait iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa13-iaa17 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa13-iaa19 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa13-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa13-iaa30 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa13-iaa34 1155384 iaa13_arath IAA13 At2g33310 1155408 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa14-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa14-iaa17 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role bait bait iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa14-iaa19 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa14-iaa26 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role bait bait iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa14-iaa27 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role bait bait iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa14-iaa28 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa14-iaa33 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa14-iaa34 1155384 iaa14_arath IAA14 At4g14550 1155409 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa15-iaa15 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role prey prey iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa15-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa15-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa15-iaa18 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa15-iaa19 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa15-iaa20 1155384 iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa15-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa15-iaa32 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa15-iaa33 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa15-iaa34 1155384 iaa15_arath IAA15 At1g80390 1155410 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa16-iaa16 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role prey prey iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa16-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa16-iaa18 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa16-iaa19 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa16-iaa26 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa16-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa16-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa16-iaa30 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa16-iaa31 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa16-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa16-iaa33 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa16-iaa34 1155384 iaa16_arath IAA16 At3g04730 1155411 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa17-iaa17 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role prey prey iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa17-iaa18 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role prey prey iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa17-iaa19 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa17-iaa20 1155384 iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa17-iaa26 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa17-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa17-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa17-iaa29 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa17-iaa31 1155384 iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa17-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa17_arath IAA17 At1g04250 1155399 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa18-iaa20 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role bait bait iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa18-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa18-iaa28 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa18-iaa31 1155384 iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa18-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa18_arath IAA18 At1g51950 1155412 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa19-iaa26 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role bait bait iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa19-iaa28 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa19-iaa31 1155384 iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa19-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa19_arath IAA19 At3g15540 1155413 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa20-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa20-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa20-iaa32 1155384 iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role prey prey iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa20-iaa33 1155384 iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa20-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa20_arath IAA20 At2g46990 1155414 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa26-iaa28 1155384 iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role bait bait iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa26-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa26-iaa34 1155384 iaa26_arath IAA26 At3g16500 1155426 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa27-iaa27 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role bait bait iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa27-iaa28 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role prey prey iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa27-iaa30 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role bait bait iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa27-iaa31 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa27-iaa33 1155384 iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa27-iaa34 1155384 iaa27_arath IAA27 At4g29080 1155415 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa28-iaa30 1155384 iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role prey prey iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa28-iaa31 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa28-iaa33 1155384 iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa28-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa28_arath IAA28 At5g25890 1155416 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa29-iaa33 1155384 iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role bait bait iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa29-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa29_arath IAA29 At4g32280 1155417 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa30-iaa33 1155384 iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role prey prey iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa30-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa30_arath IAA30 At3g62100 1155418 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa31-iaa31 1155384 iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role bait bait iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa31-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa31_arath IAA31 At3g17600 1155387 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa32-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey iaa32_arath IAA32 At2g01200 1155392 unspecified role unspecified role bait bait physical association physical association false false false Table S1 iaa33-iaa34 1155384 iaa33_arath IAA33 At5g57420 1155419 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 iaa34-iaa34 1155384 iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role bait bait iaa34_arath IAA34 At1g15050 1155393 unspecified role unspecified role prey prey physical association physical association false false false Table S1 arf5-arf5-3 1155385 n/a 1155401 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155401 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arff-arfi 1155385 n/a 1155421 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155420 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arfe-iaa12 1155385 n/a 1155401 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155407 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arff-iaa8 1155385 n/a 1155421 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155405 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf6-iaa17-1 1155385 n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155421 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf6-iaa18-1 1155385 n/a 1155421 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155412 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf6-iaa28-1 1155385 n/a 1155421 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155416 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf8-iaa12-1 1155385 n/a 1155425 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155407 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf9-iaa8 1155385 n/a 1155405 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155420 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf9-iaa17-1 1155385 n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155420 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf9-iaa18-1 1155385 n/a 1155412 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155420 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf9-iaa28-1 1155385 n/a 1155420 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155416 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 arf18-iaa17 1155385 n/a 1155422 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa8-iaa8 1155385 n/a 1155405 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155405 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa8-iaa12-1 1155385 n/a 1155405 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155407 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa8-iaa17-1 1155385 n/a 1155405 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa18-iaa8 1155385 n/a 1155405 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155412 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa28-iaa8 1155385 n/a 1155416 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155405 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa12-iaa17-1 1155385 n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155407 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa12-iaa18-1 1155385 n/a 1155407 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155412 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa17-iaa18 1155385 n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155412 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa28-iaa18 1155385 n/a 1155416 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155412 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa17-iaa17-1 1155385 n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1155399 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Figure 4 Table S2 iaa28-afb5 1155386 n/a 1155416 unspecified role unspecified role bait bait n terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false domain ii sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1155435 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 5E iaa28-tir1 1155386 n/a 1155416 unspecified role unspecified role bait bait domain ii sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1155436 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 5E iaa28-afb1 1155386 n/a 1155437 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1155416 unspecified role unspecified role bait bait domain ii sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 5E