IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hachet-2011-2 A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay anti tag western anti tag western blot anti tag western Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. Recombinant full-length Pom1 bound phospholipids in vitro with significantly higher affinity after dephosphorylation. sophie.martin@unil.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation hachet-2011-6 A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation hachet-2011-3 A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation hachet-2011-5 A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation hachet-2011-1 A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation hachet-2011-4 A Phosphorylation Cycle Shapes Gradients of the DYRK Family Kinase Pom1 at the Plasma Membrane. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hachet O., Berthelot-Grosjean M., Kokkoris K., Vincenzetti V., Moosbrugger J., Martin S.G. sophie.martin@unil.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation phosphatidyl-l-serines phosphatidyl-L-serines small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pom1_schpo DYRK-family kinase pom1 pom1 SPAC2F7.03c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGYLQSQKAVSLGDENTDALFKLHTSNRKSANMFGIKSELLNPSELSAVGSYSNDICPNRQSSSSTAADTSPSTNASNTNISFPEQEHKDELFMNVEPKGVGSSMDNHAITIHHSTGNGLLRSSFDHDYRQKNSPRNSIHRLSNISIGNNPIDFESSQQNNPSSLNTSSHHRTSSISNSKSFGTSLSYYNRSSKPSDWNQQNNGGHLSGVISITQDVSSVPLQSSVFSSGNHAYHASMAPKRSGSWRHTNFHSTSHPRAASIGNKSGIPPVPTIPPNIGHSTDHQHPKANISGSLTKSSSESKNLSTIQSPLKTSNSFFKELSPHSQITLSNVKNNHSHVGSQTKSHSFATPSVFDNNKPVSSDNHNNTTTSSQVHPDSRNPDPKAAPKAVSQKTNVDGHRNHEAKHGNTVQNESKSQKSSNKEGRSSRGGFFSRLSFSRSSSRMKKGSKAKHEDAPDVPAIPHAYIADSSTKSSYRNGKKTPTRTKSRMQQFINWFKPSKERSSNGNSDSASPPPVPRLSITRSQVSREPEKPEEIPSVPPLPSNFKDKGHVPQQRSVSYTPKRSSDTSESLQPSLSFASSNVLSEPFDRKVADLAMKAINSKRINKLLDDAKVMQSLLDRACIITPVRNTEVQLINTAPLTEYEQDEINNYDNIYFTGLRNVDKRRSADENTSSNFGFDDERGDYKVVLGDHIAYRYEVVDFLGKGSFGQVLRCIDYETGKLVALKIIRNKKRFHMQALVETKILQKIREWDPLDEYCMVQYTDHFYFRDHLCVATELLGKNLYELIKSNGFKGLPIVVIKSITRQLIQCLTLLNEKHVIHCDLKPENILLCHPFKSQVKVIDFGSSCFEGECVYTYIQSRFYRSPEVILGMGYGTPIDVWSLGCIIAEMYTGFPLFPGENEQEQLACIMEIFGPPDHSLIDKCSRKKVFFDSSGKPRPFVSSKGVSRRPFSKSLHQVLQCKDVSFLSFISDCLKWDPDERMTPQQAAQHDFLTGKQDVRRPNTAPARQKFARPPNIETAPIPRPLPNLPMEYNDHTLPSPKEPSNQASNLVRSSDKFPNLLTNLDYSIISDNGFLRKPVEKSRP 3277E7CA840F8BE2 cardiolipin 1',3'-bis(1,2-diacyl-sn-glycero-3-phospho)-sn-glycerol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 4-phosphate 1-phosphatidyl-1D-myo-inositol 4-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 4,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,4,5-trisphosphate 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tea4_schpo Tip elongation aberrant protein Tea4 SPBC1706.01 tea4 wsh3 Cell polarity protein tea4 Win1-interacting SH3 domain protein protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLHMNSASSADSMEIMESHFDPTQQNDSTIIESRYSPEEYLEQSFEIQRIISGENSEPQTVASQEISDSQEEDTTLTSSQFEDCGTEYNEVVEDDEFRSEDEDDFMDEEEEYALYEAELSSSPSIHEEVIDCNFVHAIRGFEATVEGQVDATKGDMMILLDDSNSYWWLVKMCKNLAIGYLPAEYIETPSERLARLNKYKNSETSNSQQSVTLPPLDIVEKTLEAPSPNFRIKRVTFTCSSNSSDDEMDSENDYEAMVNRTVAENGLEIEFSDSSDSSLSAEYRSESEDHVTDSPAYVDLTELEGGFNQFNSTSFQSTSPLGLEIVETEINGSSTTADSKNSHSPYSKFSSAYPDAENSNISKINISIAGNKELYGNATQSDPSLYSTWIANKHKTASSATVDSPLRRSLSVDAMQSNASFSSYSSTSNTDKSLRPSSYSAVSESSNFTHDVSRDNKEISLNAPKSIIVSQSDSFDTSNVTQDAPNDVEKEPISGQMPNNLSVQSLKQLEVYPIRHSVSIEMPSEKLLSPRLYSSSTPSSPTKGFQKDDEEDSENRKQADKVELSPSSLLRQMSLPVDSSSQSDAQCTTSSVYITAERKAFSQSSIDLSTLSNHHVNNEINRRSFAGGFTSLADELSEMRELLHESPAPLECNEEMVIPTPELDASSAIPSSSISHDEDLLPRKNTEESTSSSSFSSLITSPASLQYDENPFKQSVVAELNNNSSSVPFVDSAHASDIHAYDNDHVSTKNKEFNRRLREFILDPDSLSGLYWSVKSAGVRASRRVSRNIEGESVSSDLDDIFANVLKGLSDEMASLLNTNR pp11_schpo Serine/threonine-protein phosphatase PP1-1 dis2 bws1 SPBC776.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNPDVDLDSIIDRLLEVRGSRPGRQVQLSEDEIRFLCNKAREIFISQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLEVICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLNSMDQIQRIMRPTDVPDTGLLCDLLWSDPDKDLTGWGDNDRGVSFTFGPDVVSRFLHKHDMDLVCRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEKKQRYGYQGSSQNWHMTPPRKNKTGNSK 1106BB9C7D6FDCFB tea3_schpo Tip elongation aberrant protein 3 Cell polarity protein tea3 tea3 SPAC6G10.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVQKVLSRQSDNSQDVSAEQLDVVESGSIDQQNIRAWVVRKVKENDKRTSTNQSFKWEAVKPASCLDAANEKFMYLHGGREKSGISNSLFKLDLDSCTVYSHNRGEDNDSPARVGHSIVCSADTIYLFGGCDSETDSTFEVGDNSLYAYNFKSNQWNLVSTQSPLPSPRTGHSMLLVDSKLWIFGGECQGKYLNDIHLFDTKGVDRRTQSELKQKANANNVEKANMEFDETDWSWETPFLHSSSPPPRSNHSVTLVQGKIFVHGGHNDTGPLSDLWLFDLETLSWTEVRSIGRFPGPREGHQATTIDDTVYIYGGRDNKGLILNELWAFNYSQQRWSLVSNPIPILLSDSSSYKIVSKNNHILLLYLNALDAPKQLLCYEADPKNLYWDKDKFSDIPVLQHISMKPSNASNHTVSLGYLNDRPNHSKKNSVTSTSSSQFNNFLEQNQKAVRSARHRHYASLDEQGLHSLRNLSKTSGMNHSADFSLHEFGQADPFAYEIEKPIASLPLPNGNDTISRSSESSSPINESESNSLLKLQSDFKFSNSDDRVAWLEEQLLYCMQQGYTLKPPNLFQHVDEKLRLEKKEQLSYLEILKVIEQMLESNEQKFKKQIVSLASENAKLAAQRDAAVENANYSRSLIQKKTTDETVGSLIEKVGKLEYEVQGTLEEATSYYQKNTELQQLLKQNESASELLKSRNEKLCVDYDKLRSVFEEDSSKILSLQKENENLQSQILQISEELVDYRSRCEALEYGNYELETKLIEMHDRVEMQTNVIEASASALDVSNTAILSFEDSLRRERDEKSTLQQKCLNLQYEYENVRIELENLQSRALELESALEQSVSDAKYSKAIMQSGLSKLLSSINENKDNLKEFSKSKQKISYLESQLEGLHELLRESQRLCEGRTKELLNSQQKLYDLKHSYSSVMTEKSKLSDQVNDLTEQAKITQRKLSEVQIALADSKMNQQLSGKDSTDVHLPTDFSASSSPLRSYFNEEDSFNNASAAHSSKESDIPSGGVFTKYRNHFGNLMTSEETKAPDNNDLHKRLSDVINSQQKFLSLSPQVSKDYYDVRSKLNDTAGSFSGEEMRAIDDNYYASRIKQLEDDYQKAITYANCSDESFQQLSHSFM cdr2_schpo Mitosis inducer protein kinase cdr2 cdr2 SPAC57A10.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSTISEVGPWELGLSLGSGGPNSSRLAKHRETGQLAVVKPIVGWSELTSSQQARIEGELVLLRLIEHPNVLQLIDVISAQEQLFVVVEYMPGGELFDCMLRKGSFTEQDTAKFLWQILCGLEYCHKLHICHRDLKPENLYLDAHGSIKIGEFGMASIQQPGKLLQTSCGSPHYASPEIIMGRSYDGCASDIWSCGIIFFALLTGKLPFDDDNIRSLLLKVCQGQFEMPSNISPQAQHLLYRMLDVDSSTRITMEQIREHPFLSCFVHPNISIPIISAPIQPIDPLIVQHLSLVFRCSDDPMPLYEKLASQSPLVEKTLYTLLSRHLHPPSSAAVDRNRAVVDDLLGTAASNGQQMDEEEIEQAINIPTLAPYPISYAAESVPRPATSASPFLTPVTTSGTFNYSFNATNPQSILQRPATTSSAVPQLPKSVTPGLAYPHDSSMLSSNYRPPSALSPRNFNVSINDPEVQLSRRATSLDMSNDFRMNENDPSIVGNLAASNFPTGMGPPRKRVTSRMSEHTGNRVVSFPRGSAFNPRVTRFNVGNEQFSNNIDNNNYNQPYANATMNNSRRLRTPSGERSMRADLSQSPASYDSLNVPKHRRRQSLFSPSSTKKKLSGSPFQPKRSFLRRLFSSEPSCKCVYASLVASELEHEILEVLRRWQLLGIGIADIIYDSVSASISARIKRQNSLNLKPVRFRISVLAEFFGSQAVFVLESGSSTTFDHLATEFQLIFEDKGFLDNLELSYFQASASRPVSRMSVSSSPFAVFRQRQSVQS 2EE2EECABC8A4FAC phosphatidyl_l_-pom1 1172077 n/a 1172083 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1172084 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2D, 4D. cardiolipin-pom1 1172077 n/a 1172084 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1172085 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Fig. 2D, 4D. 1_phosphatidy-pom1-1 1172077 n/a 1172084 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1172086 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Fig. 2D, 4D. 1_phosphatidy-pom1-1 1172077 n/a 1172087 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1172084 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2D, 4D. 1_phosphatidy-pom1-2 1172077 n/a 1172088 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1172084 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2D, 4D. pom1-tea4-3 1172078 n/a 1172084 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1172089 unspecified role unspecified role neutral component neutral component n-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O60132:p.Trp167_Trp168delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6E dis2-tea4-2 1172078 n/a 1172090 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1172089 unspecified role unspecified role neutral component neutral component n-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O60132:p.Trp167_Trp168delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6E tea3-tea4 1172078 n/a 1172089 unspecified role unspecified role neutral component neutral component n-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1172091 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6E dis2-pom1 1172078 n/a 1172084 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1172089 unspecified role unspecified role ancillary ancillary n/a 1172090 unspecified role unspecified role neutral component neutral component c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6E pom1-pom1 1172079 n/a 1172084 putative self putative self putative self putative self region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast phosphorylation phosphorylation reaction phosphorylation false true false Fig. 3D Lys728Arg mutation makes Pom1 catalytically inactive. Mutation of alanines in well conserved regions outside the catalytic site reduced activity. cdr2-pom1 1172079 n/a 1172092 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast n/a 1172084 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q09690:p.Lys728Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast phosphorylation phosphorylation reaction phosphorylation false false false Fig. 3G Lys728Arg mutation makes Pom1 catalytically inactive. Mutation of alanines in well conserved regions outside the catalytic site reduced activity. pom1-tea4-2 1172080 n/a 1172089 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O60132:p.Trp167_Trp168delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1172084 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5B dis2-tea4-1 1172080 n/a 1172089 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O60132:p.Trp167_Trp168delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O60132:p.[Val235Ala;Phe237Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1172090 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6C pom1-tea4 1172081 n/a 1172089 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1172084 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 1B Addition of Ppc89 to form a Ppc89-GFP-Tea4 fusion resulted in the co-localisation occurring in the lateral cortex, but not the nuclear membrane. pom1-tea4-1 1172082 n/a 1172084 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1172089 unspecified role unspecified role prey prey sh3 region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false O60132:p.Trp167_Trp168delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false 1172174 1172172 physical association physical association false false false Fig. 5A