MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint de_alba-2011-1 Essential residues in the H-NS binding site of Hha, a co-regulator of horizontally acquired genes in Enterobacteria. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined de Alba CF., Solórzano C., Paytubi S., Madrid C., Juarez A., García J., Pons M. FEBS Lett. (0014-5793) 2011 de_alba-2011-2 Essential residues in the H-NS binding site of Hha, a co-regulator of horizontally acquired genes in Enterobacteria. ecobb Escherichia coli (strain B / BL21) pull down pull down predetermined predetermined participant predetermined de Alba CF., Solórzano C., Paytubi S., Madrid C., Juarez A., García J., Pons M. FEBS Lett. (0014-5793) 2011 hha_ecoli Hemolysin expression-modulating protein Hha b0460 JW0449 hha protein protein ecoli Escherichia coli (strain K12) MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR hns_ecoli DNA-binding protein H-NS hns bglY cur drdX hnsA msyA osmZ pilG topS b1237 Histone-like protein HLP-II Protein H1 Protein B1 JW1225 Heat-stable nucleoid-structuring protein protein protein ecoli Escherichia coli (strain K12) MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ cnu_ecoli OriC-binding nucleoid-associated protein cnu b1625 ydgT H-NS/StpA-binding protein 2 JW1617 Transcription modulator YdgT protein protein ecoli Escherichia coli (strain K12) MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLFDLGQVPKSVWHYVQ CE9FF2E890E78219 hha-hns 1144195 hha_ecoli Hha 1144197 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0ACE3:p.Glu25Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false hns_ecoli H-NS 1144198 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false [EBI-6956739] The range 2-48 was N-terminal and is not anymore. direct interaction direct interaction false false false mint f2 sf2c hha-hns-1 1144195 hns_ecoli H-NS 1144198 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false [EBI-6956777] The range 2-48 was N-terminal and is not anymore. hha_ecoli Hha 1144197 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0ACE3:p.Asp48Asn mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint f2 sf2f hha-hns-2 1144195 hns_ecoli H-NS 1144198 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false [EBI-6956799] The range 2-65 was N-terminal and is not anymore. hha_ecoli Hha 1144197 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0ACE3:p.Asp48Asn mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3 mint cnu-hns 1144195 cnu_ecoli YdgT 1144199 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P64467:p.Asp44Asn mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false hns_ecoli H-NS 1144198 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false [EBI-6956817] The range 2-48 was N-terminal and is not anymore. direct interaction direct interaction false false false sf1 mint hha-hns-3 1144196 hha_ecoli Hha 1144197 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P0ACE3:p.Glu25Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hns_ecoli H-NS 1144198 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4a mint hha-hns-4 1144196 hha_ecoli Hha 1144197 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P0ACE3:p.Asp48Asn mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hns_ecoli H-NS 1144198 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4a mint