MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint li-2011t-2 Activation of AMPK by berberine promotes adiponectin multimerization in 3T3-L1 adipocytes. in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined Li Y., Wang P., Zhuang Y., Lin H., Li Y., Liu L., Meng Q., Cui T., Liu J., Li Z. FEBS Lett. (0014-5793) 2011 li-2011t-1 Activation of AMPK by berberine promotes adiponectin multimerization in 3T3-L1 adipocytes. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Li Y., Wang P., Zhuang Y., Lin H., Li Y., Liu L., Meng Q., Cui T., Liu J., Li Z. FEBS Lett. (0014-5793) 2011 adipo_mouse Adiponectin Apm1 Adipocyte, C1q and collagen domain-containing protein 30 kDa adipocyte complement-related protein Adipocyte complement-related 30 kDa protein Adipocyte-specific protein AdipoQ Adipoq Acdc Acrp30 protein protein mouse Mus musculus Mouse MLLLQALLFLLILPSHAEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN mint Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW adipoq-1 1136433 adipo_mouse Adiponectin 1136435 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 3.0 physical association physical association false false false mint f1c f2b f2d f4b f4c adipoq-1 1136433 adipo_mouse Adiponectin 1136435 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 6.0 physical association physical association false false false mint f1c f2b f2d f4b f4c adipoq-1 1136434 adipo_mouse Adiponectin 1136435 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 3.0 physical association physical association false false false f2c mint