IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bader-2011-1 A conserved f box regulatory complex controls proteasome activity in Drosophila. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation bader-2011-2 A conserved f box regulatory complex controls proteasome activity in Drosophila. drome-testis Drosophila melanogaster testis anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation bader-2011-3 A conserved f box regulatory complex controls proteasome activity in Drosophila. drome-testis Drosophila melanogaster testis anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation bader-2011-4 A conserved f box regulatory complex controls proteasome activity in Drosophila. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation bader-2011-5 A conserved f box regulatory complex controls proteasome activity in Drosophila. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. Proteins lacking fluorescent tags visualised by immunostaining steller@rockefeller.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation nutc_drome Protein nutcracker CG10855 ntc protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDTKSEIEGFIAIPTTSGEQQQQQPQQQQNEQQVVGTKDIKAPDQVGKKQRPRLIQEKSTQETNPLILEHATLEWVPQHMDKLLNQYQECRKMPAAEWLHLLTYLVALECGFVEEETFAQKRHLIQPVPSFSSFHAQNVRILSEQPARYEVCFNDTVYIMRLRTLLDKHAPEETSLVAALQCRLMAVSLGDQLMITLSPAPPSKEPGYSVSLSIGRYVLNIQAKNKPIYHRFRKLDELSYQLKQHLFQPMRSQQLMQMEMKLQPSLLGLPDELYFEIFRYLDKSQLNVVARVNRHLHFYSKEVERKRLKGGRS psa1_drome Proteasome subunit alpha type-1 Prosalpha6 PROS-35 PROS-Dm35 Pros35 Proteasome 35 kDa subunit CG4904 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDNDTPRNDDDDDRPSPPEEPAAGPRDPEVLVATEQRP psmf1_drome Proteasome inhibitor PI31 subunit PI31 CG8979 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MESGSTAKTGDFFYGWDLLYKTVKADVSKKSDLLIALVHFLLTKHYNFRCVGVGDDKTLPEEEGSELLPDSWNDDDTKYSLRYVHDKMLYLLLGHITEGSLLINLLDINTKKVSNICVEPETLVPEVKGGITTIMPSASEIVERYRRELLDPVFTGNSREVTTQTTNSPRPIGSDPDPLRIGEPRRGGSFIPSAFEPRPFGFPDVGRGDLDPLGRGGHGNLFSFPSRPNMGPGPVPRFDPFNPLNPNRPGQGGINPDHMRPPDWNPDYYM ntc-pros35 1161020 n/a 1161025 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1161026 unspecified role unspecified role prey prey n/a 1161027 unspecified role unspecified role prey prey association association false false false Fig. 1B, Supp. Fig. 1A Proteasome subunit alpha type-7 was also identified but could not be ascribed to a single gene product. ntc-pros35-1 1161021 n/a 1161026 unspecified role unspecified role prey prey n/a 1161027 unspecified role unspecified role prey prey n/a 1161025 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Proteasome subunit alpha type-7 was also identified but could not be ascribed to a single gene product. Fig. 1A, Supp. Fig. 1B ntc-pros35-2 1161022 n/a 1161027 unspecified role unspecified role prey prey n/a 1161025 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1D, 3C Ntc also interacted with proteasome subunit alpha7 but this could not be ascribed to a single gene product. ntc-pros35-3 1161023 n/a 1161027 unspecified role unspecified role prey prey n/a 1161025 unspecified role unspecified role bait bait Q8SX86:p.Val188Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E ntc-psmf1 1161024 n/a 1161025 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1161027 unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp. Fig. 2