MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint white-2011a-1 Heme binding to the second, lower-affinity site of the global iron regulator Irr from Rhizobium leguminosarum promotes oligomerization. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined White GF., Singleton C., Todd JD., Cheesman MR., Johnston AW., Le Brun NE. FEBS J. (1742-464X) 2011 Only protein-protein interactions imex curation white-2011a-2 Heme binding to the second, lower-affinity site of the global iron regulator Irr from Rhizobium leguminosarum promotes oligomerization. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined White GF., Singleton C., Todd JD., Cheesman MR., Johnston AW., Le Brun NE. FEBS J. (1742-464X) 2011 Only protein-protein interactions imex curation q8klu1_rhilv Ferric uptake regulation protein irr RLV_7125 fur HB774_20080 E0H54_04310 protein protein rhilv Rhizobium leguminosarum bv. viciae MTGALPIAIEVRLRGAGLRPTRQRVALGDLLFAKGDRHLTVEELHEEAVAAGVPVSLATVYNTLHQFTEAGLIRVLAVESAKTYFDTNVSDHHHFFVEGENEVLDIPVSNLTIANLPEPPEGMEIAHVDVVIRLRAKQG mint irr-1 1134436 q8klu1_rhilv irr 1134438 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint f3a f3d f4 sf4 irr-1 1134436 q8klu1_rhilv irr 1134438 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 direct interaction direct interaction false false false f3d mint irr-1 1134437 q8klu1_rhilv irr 1134438 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 direct interaction direct interaction false false false f3c mint