Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com shahriari-2011-2 The Arabidopsis ESCRT protein-protein interaction network. arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Shahriari M., Richter K., Keshavaiah C., Sabovljevic A., Huelskamp M., Schellmann S. swen.schellmann@uni-koeln.de Plant Mol. Biol. (0167-4412) 2011 Only protein-protein interactions imex curation curated by molecular connections pvt. ltd. shahriari-2011-1 The Arabidopsis ESCRT protein-protein interaction network. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shahriari M., Richter K., Keshavaiah C., Sabovljevic A., Huelskamp M., Schellmann S. swen.schellmann@uni-koeln.de Plant Mol. Biol. (0167-4412) 2011 Only protein-protein interactions imex curation curated by molecular connections pvt. ltd. elc_arath Protein ELC ELC ELCH ESCRT-I complex subunit VPS23 homolog 1 Vacuolar protein-sorting-associated protein 23 homolog 1 T2E22.28 At3g12400 Protein VACUOLAR PROTEIN SORTING 23A VPS23A MQC3.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVPPPSNPQQVQQFLSSALSQRGPSSVPYEESNKWLIRQHLLNLISSYPSLEPKTASFMHNDGRSVNLLQADGTIPMPFHGVTYNIPVIIWLLESYPRHPPCVYVNPTADMIIKRPHAHVTPSGLVSLPYLQNWVYPSSNLVDLVSDLSAAFARDPPLYSRRRPQPPPPSPPTVYDSSLSRPPSADQSLPRPFPPSPYGGGVSRVQVQHVHHQQQSDDAAEVFKRNAINKMVEMVHSDLVSMRRAREAEAEELLSLQAGLKRREDELNIGLKEMVEEKETLEQQLQIISMNTDILDSWVRENQGKTKNLVDLDVDNAFECGDTLSKQMLECTALDLAIEDAIYSLDKSFQDGVVPFDQYLRNVRLLSREQFFHRATGSKVRAAQMEVQVAAIAGRLHS elcl_arath Protein ELC-like ELCL ELCHL ESCRT-I complex subunit VPS23 homolog 2 Vacuolar protein sorting-associated protein 23 homolog 2 MAC12.18 At5g13860 Protein VACUOLAR PROTEIN SORTING 23B VPS23B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPPPAKMQEIHQFLSSALTQRGPSALPYAENTKSLIRQHLLNLISSYTSLDPKTATFTHNDGRSVILLQADGTIPMPFQGVSYNIPVVIWLLESYPQYPPCVYVNPTRDMIIKRPHSNVSPSGLVSLPYLQNWIYPSSNLVDLASHLSAAFSRDPPLYSQRRPPPQPSPSIGSGYSRPLPPRQTDDAAEVYKKNAINRIVEMVHGDIVLMRSAREVETEGLLSLQSDLKRREEEINNGFKEMVIEKETLEQQLQVIAMNTDVLGSWIRENQGKAKDLLVDLDVDDSFECIDSLSKQMLECTALDLAIEDVVYSMDKSFRDGSLPFDQYLRNVRLLSREQFFHRATAEKVREIQMDAQVASIAARLHS vp371_arath Vacuolar protein-sorting-associated protein 37 homolog 1 VPS37-1 ESCRT-I complex subunit VPS37 homolog 1 T4D2.50 At3g53120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFNFWGSKDQQQGQSRPQEASSQSPWYSPSLVSSPSSSRPQSSGQISAQVSPGEAAGIIVFLKDKSVDELRKLLSDKDAYQQFLLSLDQVKVQNNIKDELRRETLQLARDNLEKEPQIMELRNQCRIIRTTELATAQEKLNELERQKEEILKFYSPGSLLHKLQEAMNQVDEESEALQEKFLEKEIDTAAFVQKYKKLRTTYHRRALIHLAAKTSNI vps36_arath Vacuolar protein sorting-associated protein 36 VPS36 ESCRT-II complex subunit VPS36 MUG13.23 At5g04920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASGSSSIAIGGLFENAEVTTSGRPVLRRNEVECFLLSSIDIDSEDDPPRFTALRSGNLILTTHRLIWIPSQSNESVPSSIPLSAVTHIYSHKKSIKSMFHSPRIRFQADPGSIVVTIVFRGKGDFDGFLSKLWECWRGRAWEEEEKSESETSKSGSGTVAQGLYGNDGTVRMVGLAGILRKEQEQWESTDKSLQDAFQDLNALMSKAKEMVSLAEKMRQKLLSAPSSQNGSTDDEEMGSKEEMQQWMLSVGIISPVTKESAGALYHQELSRQLADFVRIPLEKAGGMISLTDMYYHFNRARGTELISPDDLWQACTLWEKFDVPVMLRKFDSGVMVIQNKSHSDEEVMSRIRMLVTKTETLRVGVTASDAALTLKIAPAMAKEHLLSAETKGLLCRDMSPDGLRFYFNLFPEIDPTNLHIVKEFGTYGEWIKATSLLSV vp201_arath Vacuolar protein sorting-associated protein 20 homolog 1 VPS20.1 CHMP6-1 Charged multivesicular body protein 6 homolog 1 ESCRT-III complex subunit VPS20 homolog 1 MGI19.8 At5g63880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNLFVKKPQITEVDRAILSLKTQRRKLGQYQQKLEKVIEAEKQAARDLIREKRKDRALLALRKKRTQEELLKQVDQWVINVEQQLTDIELTSKQKAVFESLKQGNSAIKAIQSELDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEDILAEFDNLESQLIVDEMPEVPTKESEESEKLDLPDVPTKTPVASNAEITPAESATKTKVLEEPLPA vp281_arath Vacuolar protein sorting-associated protein 28 homolog 1 VPS28-1 F17L22.20 F18E5.180 At4g21560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVKLWNDKREREMYENFAELYAIIKATEKLEKAYIRDLISPSEYETECQKLIVHFKTLSASLKDMVPNIERFAETYKMDCSAAVYRLVTSGVPATVEHRAAASASTSSSASVVAECVQNFITSMDSLKLNMVAVDQVYPLLSDLSASLNKLSILPPDFEGKIKMKEWLLRLSKMGASDELTEQQARQLHFDLESSYNSFMAALPNAGN vps2b_arath Vacuolar protein sorting-associated protein 2 homolog 2 VPS2.2 CHMP2-2 Charged multivesicular body protein 2 homolog 2 ESCRT-III complex subunit VPS2 homolog 2 MFC16.25 At5g44560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNIFKKKTTPKDALRTSKREMAVATRGIEREITSLQLEEKRLVAEIKKTAKTGNEAATKILARQLVRLRQQITNLQGSRAQIRGVTTHTQALYASTSISSGMKGATKAMVAMNKQMAPTKQAKVIKDFQKQSAQLDMTIEMMSEAIDETLDKDEAEEETEDLTNQVLDEIGVGVASQLSSAPKGRIATKTAAPPASTAATNKNSESSEVDELEKRLASLRRI vp282_arath Vacuolar protein sorting-associated protein 28 homolog 2 VPS28-2 T32N4.6 At4g05000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMEVKLWNDKREREMYENFAELFAIIKATEKLEKAYIRDLINPSEYESECQKLIVHFKTLSATLKDTVPNIERFADTYKMDCPAALYRLVTSGLPATVEHRATVAASTSNSASIVAECVQNFITSMDSLKLNMVAVDQVYPLLSDLSASLNKLSILPPDFEGKTKMKEWLSRLSKMGAADELTEQQSRQLHFDLESSYNSFMAALPKAGN vps2a_arath Vacuolar protein sorting-associated protein 2 homolog 1 VPS2.1 CHMP2-1 SLP Charged multivesicular body protein 2 homolog 1 ESCRT-III complex subunit VPS2 homolog 1 SNF7-like protein T12H3.8 At2g06530 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAKQGQMGAVKVMAKDLIRTRHQIEKFYKLKSQLQGVSLRIQTLKSTQAMGEAMKGVTKAMGQMNRQMNLPSLQKIMQEFERQNEKMEMVSEVMGDAIDDALEGDEEEEETEDLVSQVLDEIGIDINQELVNAPSGAVAVPAAKNKVVQAEATGAEDSGGIDSDLQARLDNLRKM vps25_arath Vacuolar protein sorting-associated protein 25 VPS25 ESCRT-II complex subunit VPS25 F13C5 At4g19003 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKLADFKLPQFFNYPPYFTLQPVRDTREKQIQLWKELILDYCKSQKIFLIGVEEDFPLFSNSAIDRSLSHEARETFLSAIVGEGRAEWLDKGHRKCLILWHRIQDWADIVLQFVRDNGLEDSVMTVEEIRSGTESLGTELQGIDRTILMRALKLLENKGKLALFKGTSADDEGVKFSV vp202_arath Vacuolar protein sorting-associated protein 20 homolog 2 VPS20.2 CHMP6-2 Charged multivesicular body protein 6 homolog 2 ESCRT-III complex subunit VPS20 homolog 2 T2K12.4 T5E8.60 At5g09260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNLFVKKPKITEVDRAILSLKTQRRKLGQYQQQLEKVIEAEKQAARDLIREKRKDRALLALKKKRTQEELLKQVDQWLINVEQQLADIELTSKQKAVFESLKQGNNAIKAIQSEVNLDDVQKLMDDTAEAKAYQDELSAILGEKLSAEDEEEILAEFDNLESLLIVEDMPEVPTTELMPEEPEKMDLPDVPTKAPVASNETTSTKRKVLEEPLEA vp241_arath Vacuolar protein sorting-associated protein 24 homolog 1 VPS24-1 CHMP3-1 Charged multivesicular body protein 3 homolog 1 ESCRT-III complex subunit VPS24 homolog 1 MRN17.18 At5g22950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMVSAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMKAPQMAATMQEFSKEMTKAGVIEEFVNEAIDNALDSEDMEEEIDEEVDKVLTAIAGETAAELPVAVRKERIKVPAQKASTSREEEAVAEGVDDEEELEEIRARLAKVRS vps2c_arath Vacuolar protein sorting-associated protein 2 homolog 3 VPS2.3 CHMP2-3 Charged multivesicular body protein 2 homolog 3 ESCRT-III complex subunit VPS2 homolog 3 F21M11.12 At1g03950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNIFTKKPNPREVLRESKREMTQATRGIEKEIGSLQSEEKKLVLEIKRTAKSGNEGATKILARQLIRLRQQIANLQGSRAQMRGIATHTQAMHAHTSVAAGMQGATKAMAAMSKNMDPAKQAKVMREFQKQSAQMDMTTEMMSDSIDDALDNDEAEDETEDLTNQVLDEIGIDIASQLSSAPKGKIGGKKAEDVGSSGIDELEKRLAALR vp321_arath Vacuolar protein sorting-associated protein 32 homolog 1 VPS32.1 CHMP4-1 Charged multivesicular body protein 4 homolog 1 ESCRT-III complex subunit VPS32 homolog 1 SNF7A F6F22.14 At2g19830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFMNRLFGKPKQETSTLQTLDKLNETLEMLEKKENVLLKKATGEVEKAKEFSRAKNKRAAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSAPFGANDFDEDELEAELDELEGAELEEQLLQPVPIHVPQGNKPARAPAQKQPTAEEDELAALQAEMAL vp322_arath Vacuolar protein sorting-associated protein 32 homolog 2 SNF7.1 VPS32.2 CHMP4-2 Charged multivesicular body protein 4 homolog 2 ESCRT-III complex subunit VPS32 homolog 2 SNF7B F19B15.190 At4g29160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMNRLFGKPKQEANALQTLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEYSRAKNKRAAIQCLKRKRLYEGQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALATPMGAAADFDEDELAAELDELESEELESQLLQPATTAPPLPSVPVPAGRQPARPVPQKRTAEEEELAALQAEMAL vp221_arath Vacuolar protein sorting-associated protein 22 homolog 1 VP22-1 ESCRT-II complex subunit VPS22 homolog 1 F10M23.380 At4g27040 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRRRPGIGGLQKAAAARDQYRLLGENVAKLRTDMMKEQLSTFRSQLEEFARKHKNDIRKNPAFRAQFHEMCANIGVDPLASNKGFWAELLGIGDFYYELGVQIIEVCMLTRSHNGGLISLQELCNHLRQRRKKDREAVTEDDCLRAISKLKVLGSGFEVITIGKKKLVRSVPTELNKDHNQILELAQGQGFVIVEEVQRRLSWTSGRVIDALETLLEEGLAMIDNGHKDGKCRYWFPCVSSVYSSIGSDT vp372_arath Vacuolar protein-sorting-associated protein 37 homolog 2 VPS37-2 ESCRT-I complex subunit VPS37 homolog 2 F13K3.8 At2g36680 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFNFWGSKEQQQGQSRPSPEASATPWYSPSLVTSPSSSRPQTSGQIPSHVSPGEAAGIIAILKDKSVDELRKLLSDKDAYQQFLHSLDQVTIQNNIREELRKETLHLARENLEKEPQIVELRNQCRIIRTSELATAQEKLNELENQREEILKFYSPGSLLHRLQDAMNQVDEESEELQQKFMEKDIDTAAFVQKYKKLRSKYHRRALIHLAAKTSSIG elc-elc-2 1132991 n/a 1132993 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1132993 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false elc-elcl-2 1132991 n/a 1132994 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132993 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 elc-elcl-3 1132991 n/a 1132994 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132993 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 elc-vp371-2 1132991 n/a 1132993 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 elc-vp371-3 1132991 n/a 1132993 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false elc-vps36-2 1132991 n/a 1132993 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1132996 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false elc-vps36-3 1132991 n/a 1132993 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132996 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 elc-vps20_1 1132991 n/a 1132997 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132993 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 elcl-vp371-2 1132991 n/a 1132994 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 elcl-vp371-3 1132991 n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1132994 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false vp281-vp371 1132991 n/a 1132998 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vp281-vp371-1 1132991 n/a 1132998 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_2-vps28_1-2 1132991 n/a 1132998 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132999 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_2-vps28_1-1 1132991 n/a 1132998 unspecified role unspecified role neutral component neutral component yfp cyterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132999 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vp282-vp371 1132991 n/a 1133000 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false vp282-vp371-1 1132991 n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1133000 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false vp371-vp371-2 1132991 n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false vp371-vps2a-2 1132991 n/a 1133001 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false vp371-vps2a-3 1132991 n/a 1132995 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1133001 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false vp201-vps25-2 1132991 n/a 1133002 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vp201-vps25-3 1132991 n/a 1133002 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vp202-vps25-2 1132991 n/a 1133003 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1133002 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false vp202-vps25-3 1132991 n/a 1133003 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133002 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps36-vps36-3 1132991 n/a 1132996 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1132996 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false vps2a-vps36 1132991 n/a 1132996 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133001 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false vps2a-vps36-1 1132991 n/a 1132996 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133001 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps36 1132991 n/a 1132997 unspecified role unspecified role unspecified role unspecified role c-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132996 unspecified role unspecified role unspecified role unspecified role n-terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps36-1 1132991 n/a 1132996 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps36-2 1132991 n/a 1132996 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_2-vps36 1132991 n/a 1132996 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133003 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_2-vps36-1 1132991 n/a 1133003 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132996 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_1-vps28_2 1132991 n/a 1133001 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133000 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_1-vps24_1 1132991 n/a 1133001 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133004 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_2-vps25-1 1132991 n/a 1132999 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133002 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_3-vps20_1-2 1132991 n/a 1132997 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133005 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_3-vps20_1-3 1132991 n/a 1132997 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133005 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_3-vps20_2 1132991 n/a 1133003 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133005 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_3-vps20_2-1 1132991 n/a 1133003 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133005 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_3-vps32_1 1132991 n/a 1133006 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133005 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_3-vps32_1-1 1132991 n/a 1133006 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133005 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_3-vps32_2-2 1132991 n/a 1133007 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133005 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps2_3-vps32_2-3 1132991 n/a 1133007 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133005 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps20_1 1132991 n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps20_2-2 1132991 n/a 1133003 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1132997 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false vps20_1-vps20_2-3 1132991 n/a 1132997 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133003 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps24_1 1132991 n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133004 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps24_1-1 1132991 n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133004 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps32_1-2 1132991 n/a 1132997 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133006 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps32_1-3 1132991 n/a 1132997 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133006 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_1-vps32_2 1132991 n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1133007 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false vps20_1-vps32_2-1 1132991 n/a 1133007 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1132997 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false vps20_2-vps20_2 1132991 n/a 1133003 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1133003 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false vps20_2-vps24_1-2 1132991 n/a 1133003 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133004 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_2-vps24_1-3 1132991 n/a 1133003 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133004 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_2-vps32_1-2 1132991 n/a 1133006 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1133003 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false vps20_2-vps32_1-3 1132991 n/a 1133006 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1133003 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false vps20_2-vps32_2-2 1132991 n/a 1133003 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133007 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps20_2-vps32_2-3 1132991 n/a 1133003 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133007 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps24_1-vps32_1 1132991 n/a 1133006 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133004 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps24_1-vps32_1-1 1132991 n/a 1133006 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1133004 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps24_1-vps32_2 1132991 n/a 1133007 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133004 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps24_1-vps32_2-1 1132991 n/a 1133007 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133004 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps32_1-vps32_1 1132991 n/a 1133006 unspecified role unspecified role unspecified role unspecified role yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1133006 unspecified role unspecified role unspecified role unspecified role yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 2 vps32_1-vps32_2-3 1132991 n/a 1133006 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1133007 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false vps32_1-vps32_2-4 1132991 n/a 1133006 unspecified role unspecified role neutral component neutral component yfp cterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1133007 unspecified role unspecified role neutral component neutral component yfp nterm fusion yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false elc-elc-1 1132992 n/a 1132993 unspecified role unspecified role bait bait n/a 1132993 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vp22_1-elc 1132992 n/a 1132993 unspecified role unspecified role prey prey n/a 1133008 unspecified role unspecified role bait bait physical association physical association false false false Table 2 elc-elcl-1 1132992 n/a 1132993 unspecified role unspecified role bait bait n/a 1132994 unspecified role unspecified role prey prey physical association physical association false false false Table 2 elc-vp22_1 1132992 n/a 1132993 unspecified role unspecified role bait bait n/a 1133008 unspecified role unspecified role prey prey physical association physical association false false false Table 2 elcl-elc-1 1132992 n/a 1132994 unspecified role unspecified role bait bait n/a 1132993 unspecified role unspecified role prey prey physical association physical association false false false elc-vp371-1 1132992 n/a 1132995 unspecified role unspecified role prey prey n/a 1132993 unspecified role unspecified role bait bait physical association physical association false false false Table 2 vp371-elc-1 1132992 n/a 1132995 unspecified role unspecified role bait bait n/a 1132993 unspecified role unspecified role prey prey physical association physical association false false false Table 2 elc-vp372-1 1132992 n/a 1132993 unspecified role unspecified role bait bait n/a 1133009 unspecified role unspecified role prey prey physical association physical association false false false vp372-elc-1 1132992 n/a 1133009 unspecified role unspecified role bait bait n/a 1132993 unspecified role unspecified role prey prey physical association physical association false false false elc-vp201-1 1132992 n/a 1132993 unspecified role unspecified role bait bait n/a 1132997 unspecified role unspecified role prey prey physical association physical association false false false Table 2 elcl-elcl-1 1132992 n/a 1132994 unspecified role unspecified role bait bait n/a 1132994 unspecified role unspecified role prey prey physical association physical association false false false elcl-vp371-1 1132992 n/a 1132994 unspecified role unspecified role bait bait n/a 1132995 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vp371-elcl-1 1132992 n/a 1132994 unspecified role unspecified role prey prey n/a 1132995 unspecified role unspecified role bait bait physical association physical association false false false elcl-vps36-1 1132992 n/a 1132994 unspecified role unspecified role bait bait n/a 1132996 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vp22_1-vps36 1132992 n/a 1132996 unspecified role unspecified role prey prey n/a 1133008 unspecified role unspecified role bait bait physical association physical association false false false Table 2 vps36-elcl-1 1132992 n/a 1132996 unspecified role unspecified role bait bait n/a 1132994 unspecified role unspecified role prey prey physical association physical association false false false vp281-elc1 1132992 n/a 1132998 unspecified role unspecified role bait bait n/a 1132993 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vps28_1-elc 1132992 n/a 1132993 unspecified role unspecified role prey prey n/a 1132998 unspecified role unspecified role bait bait physical association physical association false false false vps28_1-elcl 1132992 n/a 1132994 unspecified role unspecified role prey prey n/a 1132998 unspecified role unspecified role bait bait physical association physical association false false false Table 2 elcl-vp22_1 1132992 n/a 1132994 unspecified role unspecified role prey prey n/a 1133008 unspecified role unspecified role bait bait physical association physical association false false false Table 2 vp281-vps2b-1 1132992 n/a 1132999 unspecified role unspecified role prey prey n/a 1132998 unspecified role unspecified role bait bait physical association physical association false false false Table 2 vps2b-vp281-1 1132992 n/a 1132999 unspecified role unspecified role bait bait n/a 1132998 unspecified role unspecified role prey prey physical association physical association false false false vp371-vp281-1 1132992 n/a 1132998 unspecified role unspecified role prey prey n/a 1132995 unspecified role unspecified role bait bait physical association physical association false false false vp371-vp282-1 1132992 n/a 1133000 unspecified role unspecified role prey prey n/a 1132995 unspecified role unspecified role bait bait physical association physical association false false false Table 2 vp22_1-vps28_2 1132992 n/a 1133000 unspecified role unspecified role prey prey n/a 1133008 unspecified role unspecified role bait bait physical association physical association false false false Table 2 vp371-vp371-1 1132992 n/a 1132995 unspecified role unspecified role bait bait n/a 1132995 unspecified role unspecified role prey prey physical association physical association false false false vp371-vps2a-1 1132992 n/a 1133001 unspecified role unspecified role prey prey n/a 1132995 unspecified role unspecified role bait bait physical association physical association false false false vps25-vp201-1 1132992 n/a 1132997 unspecified role unspecified role prey prey n/a 1133002 unspecified role unspecified role bait bait physical association physical association false false false Table 2 vps25-vp22_1 1132992 n/a 1133002 unspecified role unspecified role bait bait n/a 1133008 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vp201-vps25-1 1132992 n/a 1132997 unspecified role unspecified role bait bait n/a 1133002 unspecified role unspecified role prey prey physical association physical association false false false vps25-vp202-1 1132992 n/a 1133002 unspecified role unspecified role bait bait n/a 1133003 unspecified role unspecified role prey prey physical association physical association false false false vp202-vps25-1 1132992 n/a 1133002 unspecified role unspecified role prey prey n/a 1133003 unspecified role unspecified role bait bait physical association physical association false false false vps36-elc-2 1132992 n/a 1132993 unspecified role unspecified role prey prey n/a 1132996 unspecified role unspecified role bait bait physical association physical association false false false vps36-vps36-1 1132992 n/a 1132996 unspecified role unspecified role prey prey n/a 1132996 unspecified role unspecified role bait bait physical association physical association false false false vps36-vps2a 1132992 n/a 1132996 unspecified role unspecified role bait bait n/a 1133001 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vps36-vp201 1132992 n/a 1132997 unspecified role unspecified role prey prey n/a 1132996 unspecified role unspecified role bait bait physical association physical association false false false vp201-vps36 1132992 n/a 1132997 unspecified role unspecified role bait bait n/a 1132996 unspecified role unspecified role prey prey physical association physical association false false false vps36-vp202 1132992 n/a 1133003 unspecified role unspecified role prey prey n/a 1132996 unspecified role unspecified role bait bait physical association physical association false false false vp202-vps36 1132992 n/a 1133003 unspecified role unspecified role bait bait n/a 1132996 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vps2a-elcl 1132992 n/a 1132994 unspecified role unspecified role prey prey n/a 1133001 unspecified role unspecified role bait bait physical association physical association false false false vps2b-vps25 1132992 n/a 1133002 unspecified role unspecified role prey prey n/a 1132999 unspecified role unspecified role bait bait physical association physical association false false false vp201-vp201 1132992 n/a 1132997 unspecified role unspecified role prey prey n/a 1132997 unspecified role unspecified role bait bait physical association physical association false false false vp201-vp202 1132992 n/a 1132997 unspecified role unspecified role bait bait n/a 1133003 unspecified role unspecified role prey prey physical association physical association false false false vp202-vp201 1132992 n/a 1132997 unspecified role unspecified role prey prey n/a 1133003 unspecified role unspecified role bait bait physical association physical association false false false vp201-vp321 1132992 n/a 1132997 unspecified role unspecified role bait bait n/a 1133006 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vp321-vp201-1 1132992 n/a 1132997 unspecified role unspecified role prey prey n/a 1133006 unspecified role unspecified role bait bait physical association physical association false false false vp202-vp202 1132992 n/a 1133003 unspecified role unspecified role bait bait n/a 1133003 unspecified role unspecified role prey prey physical association physical association false false false Table 2 vp202-vp321 1132992 n/a 1133003 unspecified role unspecified role bait bait n/a 1133006 unspecified role unspecified role prey prey physical association physical association false false false vp202-vp322 1132992 n/a 1133003 unspecified role unspecified role bait bait n/a 1133007 unspecified role unspecified role prey prey physical association physical association false false false vp321-vp321 1132992 n/a 1133006 unspecified role unspecified role bait bait n/a 1133006 unspecified role unspecified role prey prey physical association physical association false false false vp322-vp321 1132992 n/a 1133006 unspecified role unspecified role prey prey n/a 1133007 unspecified role unspecified role bait bait physical association physical association false false false