IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ theurillat-2011-1 URI Is an Oncogene Amplified in Ovarian Cancer Cells and Is Required for Their Survival. human-hose Human Ovarian Surface Epithelium cell line hose HOSE - Human Ovarian Surface Epithelium a non-URI-amplified cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Theurillat JP., Metzler SC., Henzi N., Djouder N., Helbling M., Zimmermann AK., Jacob F., Soltermann A., Caduff R., Heinzelmann-Schwarz V., Moch H., Krek W. Not all the interactions from Figs 4 and 5E have been included, as the species of HA-URI and the mutant S371A is not available, neither for "active S6K1 " as used in fig S4B. holger.moch@usz.ch, wilhelm.krek@cell.biol.ethz.ch Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation theurillat-2011-2 URI Is an Oncogene Amplified in Ovarian Cancer Cells and Is Required for Their Survival. human-tov21g Homo sapiens TOV21G ovarian epithelial carcinoma cell line tov21g Human TOV21G ovarian epithelial carcinoma cell line with wt p53 gene. A highly tumourogenic cell line. TNF-alpha-producing. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Theurillat JP., Metzler SC., Henzi N., Djouder N., Helbling M., Zimmermann AK., Jacob F., Soltermann A., Caduff R., Heinzelmann-Schwarz V., Moch H., Krek W. Not all the interactions from Figs 4 and 5E have been included, as the species of HA-URI and the mutant S371A is not available, neither for "active S6K1 " as used in fig S4B. holger.moch@usz.ch, wilhelm.krek@cell.biol.ethz.ch Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation theurillat-2011-3 URI Is an Oncogene Amplified in Ovarian Cancer Cells and Is Required for Their Survival. human-skov_3 Homo sapiens ovarian adenocarcinoma cell line skov_3 Human ovarian adenocarcinoma cell line Derived from the ascitic fluid from a 64 year old caucasian female with an ovarian tumour. Forms moderately well-differentiated adenocarcinoma consistent with ovarian primary cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Theurillat JP., Metzler SC., Henzi N., Djouder N., Helbling M., Zimmermann AK., Jacob F., Soltermann A., Caduff R., Heinzelmann-Schwarz V., Moch H., Krek W. Not all the interactions from Figs 4 and 5E have been included, as the species of HA-URI and the mutant S371A is not available, neither for "active S6K1 " as used in fig S4B. holger.moch@usz.ch, wilhelm.krek@cell.biol.ethz.ch Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation theurillat-2011-4 URI Is an Oncogene Amplified in Ovarian Cancer Cells and Is Required for Their Survival. human-ovcar3 Homo sapiens OVCAR-3 ovarian adenocarcinoma cell line ovcar3 OVCAR3 human ovarian adenocarcinoma cell line Species: human, Caucasian female 60 years old; Tissue: ovary; Tumor: adenocarcinoma; Derived from: ascitic fluid anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Theurillat JP., Metzler SC., Henzi N., Djouder N., Helbling M., Zimmermann AK., Jacob F., Soltermann A., Caduff R., Heinzelmann-Schwarz V., Moch H., Krek W. Not all the interactions from Figs 4 and 5E have been included, as the species of HA-URI and the mutant S371A is not available, neither for "active S6K1 " as used in fig S4B. holger.moch@usz.ch, wilhelm.krek@cell.biol.ethz.ch Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation theurillat-2011-5 URI Is an Oncogene Amplified in Ovarian Cancer Cells and Is Required for Their Survival. human-fu_ov_1 Homo sapiens FU-OV-1 ovarian carcinoma cell line fu_ov_1 Human FU-OV-1 ovarian carcinoma (stage IIIc;, poorly differentiated serous papillary adenocarcinoma) Established post-hysterectomy from the tumor tissue of a 65-year-old Japanese woman with malignant ovarian carcinoma (stage: FIGO IIIc; histology: poorly differentiated serous papillary adenocarcinoma) in 1989. Morphology: epithelial-like adherent cells growing in monolayers. Human ovarian carcinoma established post-hysterectomy from the tumor tissue of a 65-year-old Japanese woman with malignant ovarian carcinoma (stage: FIGO IIIc; histology: poorly differentiated serous papillary adenocarcinoma) in 1989. Morphology: epithelial-like adherent cells growing in monolayers. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Theurillat JP., Metzler SC., Henzi N., Djouder N., Helbling M., Zimmermann AK., Jacob F., Soltermann A., Caduff R., Heinzelmann-Schwarz V., Moch H., Krek W. Not all the interactions from Figs 4 and 5E have been included, as the species of HA-URI and the mutant S371A is not available, neither for "active S6K1 " as used in fig S4B. holger.moch@usz.ch, wilhelm.krek@cell.biol.ethz.ch Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation rmp_human Unconventional prefoldin RPB5 interactor 1 URI1 C19orf2 NNX3 PPP1R19 Protein NNX3 Protein phosphatase 1 regulatory subunit 19 RMP RNA polymerase II subunit 5-mediating protein URI protein protein human Homo sapiens Human MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD pp1g_human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK ppp1cc-rmp 1130563 n/a 1130568 unspecified role unspecified role prey prey n/a 1130569 unspecified role unspecified role bait bait physical association physical association false false false Fig 4A, S4A ppp1cc-rmp-1 1130564 n/a 1130569 unspecified role unspecified role bait bait n/a 1130568 unspecified role unspecified role prey prey physical association physical association false false false Fig 4A ppp1cc-rmp-2 1130565 n/a 1130568 unspecified role unspecified role prey prey n/a 1130569 unspecified role unspecified role bait bait physical association physical association false false false Fig 4A ppp1cc-rmp-3 1130566 n/a 1130569 unspecified role unspecified role bait bait n/a 1130568 unspecified role unspecified role prey prey physical association physical association false false false Fig 4A ppp1cc-rmp-4 1130567 n/a 1130569 unspecified role unspecified role bait bait n/a 1130568 unspecified role unspecified role prey prey physical association physical association false false false Fig 5E, 4A.