MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint hou-2011b-1 A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Hou X., Hagemann N., Schoebel S., Blankenfeldt W., Goody RS., Erdmann KS., Itzen A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation hou-2011b-3 A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hou X., Hagemann N., Schoebel S., Blankenfeldt W., Goody RS., Erdmann KS., Itzen A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation hou-2011b-4 A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hou X., Hagemann N., Schoebel S., Blankenfeldt W., Goody RS., Erdmann KS., Itzen A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation hou-2011b-2 A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hou X., Hagemann N., Schoebel S., Blankenfeldt W., Goody RS., Erdmann KS., Itzen A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation hou-2011b-5 A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Hou X., Hagemann N., Schoebel S., Blankenfeldt W., Goody RS., Erdmann KS., Itzen A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation ocrl_human Inositol polyphosphate 5-phosphatase OCRL Inositol polyphosphate 5-phosphatase OCRL-1 Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase OCRL Lowe oculocerebrorenal syndrome protein OCRL1 protein protein human Homo sapiens Human MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQTFRFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWLGDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLMAFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEED rab1b_human Ras-related protein Rab-1B RAB1B protein protein human Homo sapiens Human MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC rab5a_human Ras-related protein Rab-5A RAB5A RAB5 protein protein human Homo sapiens Human MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN rab6a_human Ras-related protein Rab-6A RAB6A RAB6 protein protein human Homo sapiens Human MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL rab3a_human Ras-related protein Rab-3A RAB3A protein protein human Homo sapiens Human MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC rab13_human Ras-related protein Rab-13 RAB13 GIG4 Cell growth-inhibiting gene 4 protein protein protein human Homo sapiens Human MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG rab14_rat Ras-related protein Rab-14 Rab14 protein protein rat Rattus norvegicus (Rat) Rat MATTPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC rab31_human Ras-related protein Rab-31 Ras-related protein Rab-22B RAB31 RAB22B protein protein human Homo sapiens Human MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC dp13a_human DCC-interacting protein 13-alpha Adapter protein containing PH domain, PTB domain and leucine zipper motif 1 APPL1 APPL DIP13A KIAA1428 protein protein human Homo sapiens Human MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRPPTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESEA ocrl-rab1b 1158381 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1b_human Rab1b 1158387 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1158381 homomint mint SF1 f2 t1 ocrl-rab5a 1158381 rab5a_human Rab5a 1158388 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1158381 homomint mint SF1 f2 t1 ocrl-rab6a 1158381 rab6a_human Rab6a 1158389 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1158381 homomint mint SF1 f2 t1 ocrl-rab8a 1158381 rab8a_human Rab8a 1158390 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1158381 homomint mint SF1 f2 t1 f5c ocrl-rab8a-1 1158381 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q01968:p.Phe668Val mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab8a_human Rab8a 1158390 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1158381 homomint mint SF1 f2 t1 f5c ocrl-rab3a 1158381 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab3a_human Rab3a 1158391 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false SF1 homomint mint ocrl-rab13 1158381 rab13_human Rab13 1158392 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false SF1 homomint mint ocrl-rab14 1158381 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab14_rat Rab14 1158393 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false SF1 homomint mint ocrl-rab31 1158381 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab31_human Rab31 1158394 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false SF1 homomint mint ocrl-rab8a-3 1158382 rab8a_human Rab8a 1158390 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q01968:p.Phe668Val mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false SF6 homomint mint ocrl-rab8a-4 1158382 rab8a_human Rab8a 1158390 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q01968:p.Phe668Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false SF6 homomint mint ocrl-rab8a-5 1158382 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false rab8a_human Rab8a 1158390 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false SF3 homomint mint ocrl-rab1b-1 1158382 rab1b_human Rab1b 1158387 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q01968:p.Phe668Val mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false SF6 homomint mint ocrl-rab5a-1 1158382 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q01968:p.Phe668Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false rab5a_human Rab5a 1158388 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false SF6 homomint mint ocrl-rab6a-1 1158382 rab6a_human Rab6a 1158389 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q01968:p.Phe668Val mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false SF6 homomint mint ocrl-rab8a-6 1158383 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q01968:p.Phe668Val mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab8a_human Rab8a 1158390 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f5d homomint mint ocrl-appl1 1158383 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dp13a_human APPL1 1158395 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f5d homomint mint ocrl-rab8a-2 1158384 ocrl_human OCRL1 1158386 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab8a_human Rab8a 1158390 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f3 t2 ocrl-rab8a-7 1158385 ocrl_human OCRL1 1158386 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rab8a_human Rab8a 1158390 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false sf2 homomint mint