MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint abed-2011-2 Degringolade, a SUMO-targeted ubiquitin ligase, inhibits Hairy/Groucho-mediated repression. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Abed M., Barry KC., Kenyagin D., Koltun B., Phippen TM., Delrow JJ., Parkhurst SM., Orian A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation abed-2011-3 Degringolade, a SUMO-targeted ubiquitin ligase, inhibits Hairy/Groucho-mediated repression. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abed M., Barry KC., Kenyagin D., Koltun B., Phippen TM., Delrow JJ., Parkhurst SM., Orian A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation abed-2011-1 Degringolade, a SUMO-targeted ubiquitin ligase, inhibits Hairy/Groucho-mediated repression. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Abed M., Barry KC., Kenyagin D., Koltun B., Phippen TM., Delrow JJ., Parkhurst SM., Orian A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation abed-2011-4 Degringolade, a SUMO-targeted ubiquitin ligase, inhibits Hairy/Groucho-mediated repression. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. pull down pull down predetermined predetermined participant predetermined Abed M., Barry KC., Kenyagin D., Koltun B., Phippen TM., Delrow JJ., Parkhurst SM., Orian A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation abed-2011-5 Degringolade, a SUMO-targeted ubiquitin ligase, inhibits Hairy/Groucho-mediated repression. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Abed M., Barry KC., Kenyagin D., Koltun B., Phippen TM., Delrow JJ., Parkhurst SM., Orian A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation q9vnj0_drome dgrn Dgrn Dmel\CG10981 STUbL Dmel_CG10981 CG10981 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDSTIFRFNSSILDQSADSNVSSSSSNSSVSDSSVDSHSSIESNSGHNTSVESQSSAESDSSADSHSSLERPSPVERDLSVESDSSSATNTSESSVGEASNQLQSPQSNNPLNMANLSVSTEDAHSQIRSLTQDVIQMEAELDRMNRYCEEVVAQIDTFATRTSTPTTRRIRRRTSPVEVIDLSHLDRAPPVRSARNRDPDAFIDLCTPEGPRSRTVNLHSNDSLTILPRRSAENDPVVDLDVASPPKRVNRDIDESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIRATHKCPICNKKLTARQFFRIYL o97102_drome Small ubiquitin-related modifier smt3 Smt3 DmSUMO-1 Dm0342 DmSmt3 Dmel\CG4494 Dmsmt3 SMT3 SUMO Sumo anon-EST:Posey240 dSmt3 dsmt3 l(2)04493 l(2)SH0182 l(2)SH2 0182 CG4494 sumo Dmel_CG4494 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP hair_drome Protein hairy CG6494 h protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVTGVTAANMTNVLGTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW ctbp_drome C-terminal-binding protein CtBP CG7583 dCtBP protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDKNLMMPKRSRIDVKGNFANGPLQARPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNVFQGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNKEYFMRTPPAAAAGGVAAAVYPEGALHHRAHSTTPHDGPHSTTNLGSTVGGGPTTVAQAAAAAVAAAAAAALLPSPVPSHLSPQVGGLPLGIVSSQSPLSAPDPNNHLSSSIKTEVKAESTEAP grou_drome Protein groucho gro E(spl)m9/m10 CG8384 Enhancer of split m9/10 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYPSPVRHPAAGGPPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGHQQQHGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGPQGLLNKPPEHHRPDIKPTGLEGPAAAEERLRNSVSPADREKYRTRSPLDIENDSKRRKDEKLQEDEGEKSDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQERPPSRSGSSSSRSTPSLKTKDMEKPGTPGAKARTPTPNAAAPAPGVNPKQMMPQGPPPAGYPGAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY smt3-dgrn 1141983 q9vnj0_drome Dgrn 1141988 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o97102_drome SUMO 1141989 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1g homomint mint dgrn-h 1141983 q9vnj0_drome Dgrn 1141988 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hair_drome Hairy 1141990 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction false false false mint f1h dgrn-h-1 1141983 hair_drome Hairy 1141990 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9vnj0_drome Dgrn 1141988 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q9VNJ0:p.Cys302Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9VNJ0:p.His300Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false mint f1i h-dgrn 1141983 q9vnj0_drome Dgrn 1141988 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated hair_drome Hairy 1141990 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint f1j dgrn-h-2 1141983 hair_drome Hairy 1141990 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false q9vnj0_drome Dgrn 1141988 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false mint sf1b sf1c sf5b h-dgrn-1 1141984 q9vnj0_drome Dgrn 1141988 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hair_drome Hairy 1141990 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P14003:p.Arg33Glu mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false domino mint f1k h-ctbp-2 1141984 ctbp_drome dCtBP 1141991 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hair_drome Hairy 1141990 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f1k h-gro-1 1141984 hair_drome Hairy 1141990 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false grou_drome Gro 1141992 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f1k dgrn-smt3 1141985 o97102_drome SUMO 1141989 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell q9vnj0_drome Dgrn 1141988 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f1f homomint mint smt3-gro 1141986 o97102_drome SUMO 1141989 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grou_drome Gro 1141992 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint f5c sf3f gro-smt3 1141987 grou_drome Gro 1141992 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o97102_drome SUMO 1141989 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint f5d