Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com kulyte-2011-1 CIDEA interacts with liver X receptors in white fat cells. in vitro In vitro pull down pull down autoradiography autoradiography Kulyte A., Pettersson AT., Antonson P., Stenson BM., Langin D., Gustafsson JK., Staels B., Ryden M., Arner P., Laurencikiene J. Apoptosis - Interactions involving proteins with a function related to apoptosis Participant detection method taken from back reference- PMID: 10681503 Jurga.Laurencikiene@ki.se FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation curated by molecular connections pvt. ltd. cidea_human Cell death activator CIDE-A Cell death-inducing DFFA-like effector A CIDEA protein protein human Homo sapiens Human MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG nr1h2_human Oxysterols receptor LXR-beta Ubiquitously-expressed nuclear receptor Nuclear receptor NER Liver X receptor beta Nuclear receptor subfamily 1 group H member 2 NR1H2 LXRB NER UNR protein protein human Homo sapiens Human MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE nr1h2-cidea-1 1132969 n/a 1132970 unspecified role unspecified role prey prey 35s-cys-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1132971 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false fig. 2a