MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint keane-2011-1 Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-α. in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Keane FM., Nadvi NA., Yao TW., Gorrell MD. FEBS J. (1742-464X) 2011 gluc_human Pro-glucagon GCG protein protein human Homo sapiens Human MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK mint homomint sepr_human Prolyl endopeptidase FAP Integral membrane serine protease FAP 170 kDa melanoma membrane-bound gelatinase Fibroblast activation protein alpha Dipeptidyl peptidase FAP Gelatine degradation protease FAP Post-proline cleaving enzyme Serine integral membrane protease Surface-expressed protease protein protein human Homo sapiens Human MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVTDERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYDAISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPGRRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD gip_human Gastric inhibitory polypeptide Incretin hormone GIP Glucose-dependent insulinotropic polypeptide protein protein human Homo sapiens Human MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR mint dpp4_human Dipeptidyl peptidase 4 DPP4 ADCP2 CD26 ADABP Adenosine deaminase complexing protein 2 Dipeptidyl peptidase IV T-cell activation antigen CD26 TP103 protein protein human Homo sapiens Human MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP vip_human VIP peptides VIP protein protein human Homo sapiens Human MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK slib_human Somatoliberin GHRH GHRF Growth hormone-releasing factor Growth hormone-releasing hormone Somatocrinin Somatorelin protein protein human Homo sapiens Human MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG mint pyy_human Peptide YY PYY PYY-I Peptide tyrosine tyrosine protein protein human Homo sapiens Human MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW anfb_human Natriuretic peptides B NPPB Gamma-brain natriuretic peptide Brain natriuretic factor prohormone Iso-ANP protein protein human Homo sapiens Human MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH npy_human Pro-neuropeptide Y NPY protein protein human Homo sapiens Human MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW tkn1_human Protachykinin-1 PPT TAC1 NKA NKNA TAC2 protein protein human Homo sapiens Human MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR paca_human Pituitary adenylate cyclase-activating polypeptide ADCYAP1 protein protein human Homo sapiens Human MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL mint Stimulates adenylate cyclase in pituitary cells ccl5_human C-C motif chemokine 5 CCL5 D17S136E SCYA5 EoCP Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES protein protein human Homo sapiens Human MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS ccl11_human Eotaxin C-C motif chemokine 11 Small-inducible cytokine A11 Eosinophil chemotactic protein CCL11 SCYA11 protein protein human Homo sapiens Human MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP ccl22_human C-C motif chemokine 22 CCL22 MDC SCYA22 CC chemokine STCP-1 MDC(1-69) Macrophage-derived chemokine Small-inducible cytokine A22 Stimulated T-cell chemotactic protein 1 A-152E5.1 protein protein human Homo sapiens Human MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ cxcl2_human C-X-C motif chemokine 2 CXCL2 GRO2 GROB MIP2A SCYB2 Macrophage inflammatory protein 2-alpha Growth-regulated protein beta protein protein human Homo sapiens Human MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN cxcl9_human C-X-C motif chemokine 9 CXCL9 CMK MIG SCYB9 Gamma-interferon-induced monokine Monokine induced by interferon-gamma Small-inducible cytokine B9 protein protein human Homo sapiens Human MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT cxl10_human C-X-C motif chemokine 10 CXCL10 INP10 SCYB10 Small-inducible cytokine B10 10 kDa interferon gamma-induced protein protein protein human Homo sapiens Human MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP mint Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3 sdf1_human Stromal cell-derived factor 1 CXCL12 SDF1 SDF1A SDF1B C-X-C motif chemokine 12 Intercrine reduced in hepatomas Pre-B cell growth-stimulating factor protein protein human Homo sapiens Human MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM cxl11_human C-X-C motif chemokine 11 CXCL11 ITAC SCYB11 SCYB9B Beta-R1 H174 Interferon gamma-inducible protein 9 Interferon-inducible T-cell alpha chemoattractant Small-inducible cytokine B11 protein protein human Homo sapiens Human MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF fap-gcg 1015749 gluc_human GLP-1-amide 1015750 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f5 fap-gcg-1 1015749 gluc_human GLP-2 1015750 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f5 dpp4-gip 1015749 gip_human GIP 1015752 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate unspecified role unspecified role in vitro translated in vitro translated protein in vitro translated dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f7 fap-vip 1015749 vip_human PHM 1015754 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f6 fap-ghrh 1015749 slib_human GRF 1015755 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f6 fap-pyy 1015749 sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pyy_human PYY 1015756 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f3 fap-nppb 1015749 sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false anfb_human BNP 1015757 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f4 fap-npy 1015749 sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false npy_human NPY 1015758 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f3 fap-tac1 1015749 tkn1_human Substance P 1015759 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f4 dpp4-gcg 1015749 gluc_human GLP-1-amide 1015750 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f5 dpp4-gcg-1 1015749 gluc_human GLP-2 1015750 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f5 fap-gip 1015749 gip_human GIP 1015752 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate unspecified role unspecified role in vitro translated in vitro translated protein in vitro translated sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f7 dpp4-gcg-2 1015749 gluc_human Glucagon 1015750 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf1 dpp4-vip 1015749 vip_human PHM 1015754 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f6 dpp4-ghrh 1015749 slib_human GRF 1015755 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f6 dpp4-gcg-3 1015749 gluc_human Oxyntomodulin 1015750 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf2 dpp4-vip-1 1015749 dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false vip_human VIP 1015754 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf1 adcyap1-dpp4 1015749 paca_human PACAP 1015760 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf2 dpp4-pyy 1015749 dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pyy_human PYY 1015756 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f3 dpp4-nppb 1015749 anfb_human BNP 1015757 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f4 dpp4-npy 1015749 dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false npy_human NPY 1015758 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f3 dpp4-tac1 1015749 dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tkn1_human Substance P 1015759 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 f4 ccl5-dpp4 1015749 dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ccl5_human CCL5 -RANTES 1015761 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf3 ccl11-dpp4-1 1015749 dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ccl11_human CCL11-Eotaxin 1015762 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf4 ccl22-dpp4 1015749 ccl22_human CCL22-MDC 1015763 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf4 cxcl2-dpp4-1 1015749 cxcl2_human CXCL2-GRObeta 1015764 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf5 cxcl9-dpp4-1 1015749 dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cxcl9_human CXCL9-MIG 1015765 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf6 cxcl10-dpp4-1 1015749 cxl10_human CXCL10-IP10 1015766 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf6 cxcl12-dpp4 1015749 sdf1_human CXCL12-SDF1A 1015767 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf7 cxcl11-dpp4-1 1015749 cxl11_human CXCL11 ITAC 1015768 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dpp4_human DPP4 1015753 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf7 fap-vip-1 1015749 vip_human VIP 1015754 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf1 fap-gcg-2 1015749 gluc_human Glucagon 1015750 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf1 adcyap1-fap 1015749 paca_human PACAP 1015760 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf2 fap-gcg-3 1015749 gluc_human Oxyntomodulin 1015750 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sepr_human FAP 1015751 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint t1 t2 sf2