IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xu-2011-1 Oncometabolite 2-Hydroxyglutarate Is a Competitive Inhibitor of α-Ketoglutarate-Dependent Dioxygenases. in vitro In vitro demethylase assay demethylase assay sequence tag sequence tag identification sequence tag Xu W., Yang H., Liu Y., Yang Y., Wang P., Kim SH., Ito S., Yang C., Wang P., Xiao MT., Liu LX., Jiang WQ., Liu J., Zhang JY., Wang B., Frye S., Zhang Y., Xu YH., Lei QY., Guan KL., Zhao SM., Xiong Y. kuguan@ucsd.edu, zhaosm@fudan.edu.cn, yxiong@email.unc.edu. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation xu-2011-2 Oncometabolite 2-Hydroxyglutarate Is a Competitive Inhibitor of α-Ketoglutarate-Dependent Dioxygenases. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu W., Yang H., Liu Y., Yang Y., Wang P., Kim SH., Ito S., Yang C., Wang P., Xiao MT., Liu LX., Jiang WQ., Liu J., Zhang JY., Wang B., Frye S., Zhang Y., Xu YH., Lei QY., Guan KL., Zhao SM., Xiong Y. kuguan@ucsd.edu, zhaosm@fudan.edu.cn, yxiong@email.unc.edu. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation q92133_xenla Histone H3 h3c8.S H3l h3c8 hist1h3g protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA kdm7_caeel Lysine-specific demethylase 7 homolog jmjd-1.2 JmjC domain-containing protein 1.2 PHD finger protein 8 homolog PHF8 homolog F29B9.2 protein protein caeel Caenorhabditis elegans MDGNDINIQKNEFSRDQSALLMMDQHSDHKNHESAIGEPGMSYTASQPALSSTEHQTPLVSEASVAAPQNHLNGNSHESVSEMDRNSVDFAIESVLMKARAYNKMGAPKDPRRKQHNPKSEPKIEPHVTDSSDNQAAMSNKMEAEAPKMESNQNYVSNGSEPPFRFVSISNFDEMKTKKKEVQEELKLEVDSDSEEDDVPEQKTPKESDRCGGCGKFTHEDDLIALEEEKKKEKEKPLMSKKKSHHHKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVSGAEYIKLLQREEYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNKPMGLKQKRKSRESAERDDEDYCPSSSTAYKKKYTKKAKKDNDDAPKVKKAKKEEVPEEKVPVPEAAGPSEVTAPLTIKIGMGPTEDQKGVVQIFNNQCTSSGRKVKLNQNVADYCGSHLEARVEEIPEKATKSFRELDNELERCEAVHSGEKIKKVKEPKPPKQPKEKKEKPPPKKKEMSSRDRLMKKLKM h3_caeel Histone H3 his-2 his-6 his-9 his-13 his-17 his-25 his-27 his-32 his-42 his-45 his-49 his-55 his-59 his-63 T10C6.13 F45F2.13 ZK131.3 ZK131.7 K06C4.5 ZK131.2 K06C4.13 F17E9.10 F08G2.3 B0035.10 F07B7.5 F54E12.1 F55G1.2 F22B3.2 protein protein caeel Caenorhabditis elegans MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA iron2plus iron(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) r-2-hg (R)-2-hydroxyglutaric acid OR (2R)-2-hydroxypentanedioic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) a-kg alpha-ketoglutarate OR 2-OXOGLUTARIC ACID small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) kdm7-q92133 1016380 n/a 1016382 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false dimethyl_lysine melys methylated lysine MeLys certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1016383 enzyme enzyme neutral component neutral component demethylation demethylation reaction demethylation false false false 2-hydroxyglutarate, D>Lform. Fig 1A, 1B, S1. α-ketoglutarate kdm7-q92133-1 1016380 n/a 1016384 enzyme target enzyme target substrate substrate neutral component neutral component dimethyl_lysine melys methylated lysine MeLys certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1016383 enzyme enzyme neutral component neutral component demethylation demethylation reaction demethylation false false false 2-hydroxyglutarate, D>Lform. Fig 1A, 1B, S1. α-ketoglutarate iron2plus-kdm7-1 1016381 n/a 1016385 unspecified role unspecified role neutral component neutral component n/a 1016386 unspecified role unspecified role neutral component neutral component n/a 1016383 unspecified role unspecified role neutral component neutral component jmjc_domain sufficient to bind sufficient binding region sufficient to bind range range range range false asp-497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1016387 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig 2A, Table 1, Fig S2. Working R factor of 21.4%, Free R-factor: 25.05%. 2.1A. a_kg-iron2plus 1016381 n/a 1016383 unspecified role unspecified role neutral component neutral component jmjc_domain sufficient to bind sufficient binding region sufficient to bind range range range range false asp-497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1016387 unspecified role unspecified role neutral component neutral component n/a 1016385 unspecified role unspecified role neutral component neutral component n/a 1016388 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig 2B, Table 1. Working R factor of 18.75%, Free R-factor: 22.36%. 2.25A.