MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint g_ndo_du-2011-1 Large ring polymers align FtsZ polymers for normal septum formation. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gündoğdu ME., Kawai Y., Pavlendova N., Ogasawara N., Errington J., Scheffers DJ., Hamoen LW. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation gundogdu-2011-2 Large ring polymers align FtsZ polymers for normal septum formation. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Gündoğdu ME., Kawai Y., Pavlendova N., Ogasawara N., Errington J., Scheffers DJ., Hamoen LW. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation gundogdu-2011-1 Large ring polymers align FtsZ polymers for normal septum formation. in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Gündoğdu ME., Kawai Y., Pavlendova N., Ogasawara N., Errington J., Scheffers DJ., Hamoen LW. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation gundogdu-2011-3 Large ring polymers align FtsZ polymers for normal septum formation. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gündoğdu ME., Kawai Y., Pavlendova N., Ogasawara N., Errington J., Scheffers DJ., Hamoen LW. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation sepf_bacsu Cell division protein SepF BSU15390 sepF ylmF protein protein bacsu Bacillus subtilis MSMKNKLKNFFSMEDEEYEYEYIETERESHEEHEQKEKPAYNGNKPAGKQNVVSLQSVQKSSKVVLSEPRVYAEAQEIADHLKNRRAVVVNLQRIQHDQAKRIVDFLSGTVYAIGGDIQRIGSDIFLCTPDNVDVSGTISELISEDEHQRW ftsz_bacsu Cell division protein FtsZ ftsZ BSU15290 protein protein bacsu Bacillus subtilis MLEFETNIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKREPKREEPQQQNTVSRHTSQPADDTLDIPTFLRNRNKRG sepf-ftsz 1022166 sepf_bacsu sepF 1022170 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ftsz_bacsu ftsZ 1022171 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false mint f8a f7c sepf-ftsz-1 1022166 sepf_bacsu sepF 1022170 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ftsz_bacsu ftsZ 1022171 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false mint f8a f7c sepf-1 1022167 sepf_bacsu sepF 1022170 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint f1a f1b f7b ftsz-4 1022167 ftsz_bacsu ftsZ 1022171 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f3a mint ftsz-4 1022168 ftsz_bacsu ftsZ 1022171 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint sf3 f2b sepf-1 1022169 sepf_bacsu sepF 1022170 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false f7a mint