UniProt UniProt http://www.uniprot.org pourcher-2010-2 Analyses of sorting nexins reveal distinct retromer-subcomplex functions in development and protein sorting in Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pourcher M., Santambrogio M., Thazar N., Thierry A.M., Fobis-Loisy I., Miege C., Jaillais Y., Gaude T. thierry.gaude@ens-lyon.fr Plant Cell (1040-4651) 2010 Only protein-protein interactions imex curation pourcher-2010-4 Analyses of sorting nexins reveal distinct retromer-subcomplex functions in development and protein sorting in Arabidopsis thaliana. tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Pourcher M., Santambrogio M., Thazar N., Thierry A.M., Fobis-Loisy I., Miege C., Jaillais Y., Gaude T. thierry.gaude@ens-lyon.fr Plant Cell (1040-4651) 2010 Only protein-protein interactions imex curation pourcher-2010-1 Analyses of sorting nexins reveal distinct retromer-subcomplex functions in development and protein sorting in Arabidopsis thaliana. arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Pourcher M., Santambrogio M., Thazar N., Thierry A.M., Fobis-Loisy I., Miege C., Jaillais Y., Gaude T. thierry.gaude@ens-lyon.fr Plant Cell (1040-4651) 2010 Only protein-protein interactions imex curation pourcher-2010-3 Analyses of sorting nexins reveal distinct retromer-subcomplex functions in development and protein sorting in Arabidopsis thaliana. arath-leaf Arabidopsis thaliana leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pourcher M., Santambrogio M., Thazar N., Thierry A.M., Fobis-Loisy I., Miege C., Jaillais Y., Gaude T. thierry.gaude@ens-lyon.fr Plant Cell (1040-4651) 2010 Only protein-protein interactions imex curation snx1_arath Sorting nexin 1 SNX1 VPS5 Vacuolar protein sorting-associated protein 5 homolog K16F4.11 MBL20 At5g06140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESTEQPRNISGSMQSPRSPSSHPYLSVSVTDPVKLGNGVQAYISYRVITKTNLPEYQGPEKIVIRRYSDFVWLRDRLFEKYKGIFIPPLPEKSAVEKFRFSAEFIEMRRAALDIFVNRIALHPELQQSEDLRTFLQADEETMDRFRFQETSIFKKPADLMQMFRDVQSKVSDAVLGKEKPVEETTADYEKLKHYIFELENHLTEAQKHAYRLVKRHRELGQSLLDFGKAVKLLGACEGEPTGKAFSDLGTKSELLSIKLQKEAQQVLMNFEEPLKDYVRYVQSIKATIAERGTAFKQHCELSETTKLKEINLDKLMLTRSDKVGEAEIEYREIKAESEEATRRFERIVKRMEDEIVRFQEQKTEEMGVAFHQFAKGQARLANSVADAWRSLLPKLEASYSV snx2a_arath Sorting nexin 2A SNX2A MQJ2.4 At5g58440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMGSENADGFEETNLNAQRDDMENLDLGVDGGDHPLKISDVNGDTSNSGYRSAMSTLSNVRDPLSPPPTVMIPADSDPLLAPSSYEDFRSSFSSKPISSDNSYIEPPSYADVIFSPFDENSDSEINGTEDNSLHSQFSDSLSRSPSSSSSDYIKITVSNPQKEQEISNSIVGGNTYITYQITTRTNLPDFGGPSEFSVRRRFRDVVTLADRLAETYRGFCIPPRPDKSVVESQVMQKQEFVEQRRVALEKYLRRLSAHPVIRNSDELKVFLQVQGKLPLPMSTDVASRMLDGAVKLPKQLFGEGGASAVPVTEVGQPARGGRDLLRLFKELRQSVSNDWGGSKPPVVEEDKEFLEKKEKMHDLEQQIINASQQAESLVKAQQDMGETMGELGLAFIKLTKFENEEAVCNPQRTRANDMKNLATAAVKASRFYRELNSQTVKHLDTLHEYLGMMMAVQGAFADRSSALLTVQTLLSELPSLQTRVEKLEAASSKVFGGDKSRIRKIEELKETIKVTEDAKNVAIKGYERIKENNRSEVERLDRERRADFMNMMKGFVVNQVGYAEKMGNVWAKVAEETSQYDREKQSS snx2b_arath Sorting nexin 2B SNX2B T28J14_60 At5g07120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMGSENDEESHLHSSKEEMEKLFLREDGDPLTKSNVNGDKSNSNYRSAMSTLFDSRHPSIVVTPADSDPLFAPPSYYSESRSPRSKPNGGDRVSSYLEPPSYADVIFSPFDDISEINGSEDGHSQSSDSLSRSPSSLSSDYIKITVSNPQKEQEATNSMIPGGSTYITYQITTRTNLSDYGGSEFSVRRRFRDIVTLADRLAESYRGFCIPPRPDKSIVESQVMQKQEFVEQRRVALEKYLRRLVAHPVIRNSDELKVFLQAQGKLPLATSTDVASRMLDGAVKLPKQLFGEGGGASSVEVVQPGRGGRDFLRMFKELRQSVSNDWGGSKPPVVEEDKEFLEKKEKMYDLEQQIINASQQAESLVKAQQDMGETMGELGLAFIKLTKFENEEAVFNSQRARANDMKNLATSAVKASRFYRELNSQTVKHLDTLHDYLGLMMAVQGAFADRSSALLTVQTLLSELSSLEARAEKLEVASSKVFGGDKSRIKKIEELKETIKVTEDSKNVAIREYEQIKENNWSEVERLDRERRADFLNMMKGFVANQVGYAEKIANVWTKVAEETRQYDRESS snx1-snx1-1 1239728 n/a 1239732 unspecified role unspecified role prey prey n/a 1239732 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false bar domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false physical association physical association false false false Fig.5C, Suppl. Fig 6D snx2a-snx1 1239728 n/a 1239733 unspecified role unspecified role bait bait n/a 1239732 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5C snx1-snx2a-1 1239728 n/a 1239732 unspecified role unspecified role bait bait n/a 1239733 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5C snx2a-snx2a 1239728 n/a 1239733 unspecified role unspecified role prey prey n/a 1239733 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5C snx1-snx2b-1 1239728 n/a 1239734 unspecified role unspecified role prey prey n/a 1239732 unspecified role unspecified role bait bait bar domain sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false Fig. 5C, Suppl. Fig. 6F snx1-snx2b-3 1239728 n/a 1239734 unspecified role unspecified role prey prey bar2b domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false n/a 1239732 unspecified role unspecified role bait bait physical association physical association false false false Suppl. Fig. 6E snx2b-snx1-3 1239728 n/a 1239732 unspecified role unspecified role prey prey bar1 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false n/a 1239734 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5C, Suppl. Fig. 6F snx2b-snx1-2 1239728 n/a 1239732 unspecified role unspecified role prey prey bar1 sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1239734 unspecified role unspecified role bait bait physical association physical association false false false Suppl. Fig. 6F snx2b-snx2b 1239728 n/a 1239734 unspecified role unspecified role bait bait n/a 1239734 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5C snx2a-snx2b-2 1239728 n/a 1239733 unspecified role unspecified role bait bait n/a 1239734 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5C snx2b-snx2a 1239728 n/a 1239734 unspecified role unspecified role bait bait n/a 1239733 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5C snx1-snx2b 1239729 n/a 1239734 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239732 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6A, 6I snx2b-snx2b-1 1239729 n/a 1239734 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239734 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Suppl. Fig. 7C snx1-snx1 1239729 n/a 1239732 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239732 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6B snx2a-snx2b-1 1239729 n/a 1239734 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239733 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5C snx1-snx2a-4 1239729 n/a 1239733 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239732 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Suppl. Fig. 7A snx2a-snx2a-1 1239729 n/a 1239733 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239733 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Suppl. Fig. 7B snx1-snx2a 1239730 n/a 1239732 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239733 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5A snx2a-snx2b 1239730 n/a 1239734 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239733 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5B snx1-snx2b-2 1239730 n/a 1239732 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239734 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Suppl. Fig. 4A snx1-snx2a-3 1239731 n/a 1239733 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239732 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5D snx2a-snx1-1 1239731 n/a 1239733 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239732 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Suppl. Fig. 6G snx2b-snx1-1 1239731 n/a 1239732 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1239734 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Suppl. Fig. 6H