UniProt UniProt http://www.uniprot.org florek-2011-1 The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis. ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Florek P., Levdikov V.M., Blagova E., Lebedev A.A., Skrabana R., Resetarova S., Pavelcikova P., Barak I., Wilkinson A.J. Paper says aa 80-248 of SpoIISA, PDB says 92-248 ajw@ysbl.york.ac.uk J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation florek-2011-2 The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Florek P., Levdikov V.M., Blagova E., Lebedev A.A., Skrabana R., Resetarova S., Pavelcikova P., Barak I., Wilkinson A.J. Paper says aa 80-248 of SpoIISA, PDB says 92-248 ajw@ysbl.york.ac.uk J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation florek-2011-3 The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Florek P., Levdikov V.M., Blagova E., Lebedev A.A., Skrabana R., Resetarova S., Pavelcikova P., Barak I., Wilkinson A.J. Paper says aa 80-248 of SpoIISA, PDB says 92-248 ajw@ysbl.york.ac.uk J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation sp2sa_bacsu Stage II sporulation protein SA spoIISA ykaC BSU12830 Killer protein SpoIISA Toxin SpoIISA protein protein bacsu Bacillus subtilis MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAFIFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASLCHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVLPIEEEGEG sp2sb_bacsu Stage II sporulation protein SB spoIISB Antidote protein SpoIISB Antitoxin SpoIISB BSU12820 protein protein bacsu Bacillus subtilis MERAFQNRCEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEYKRKKA spoiisa-spoiisb 1184527 n/a 1184530 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 n/a 1184531 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 direct interaction direct interaction false false false Table 3 2.5A Rworking = 0.19589 Rfree = 0.25778 spoiisa-spoiisb-1 1184528 n/a 1184530 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1184531 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 2A spoiisa-spoiisb-3 1184529 n/a 1184530 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1184531 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false fig 2B