IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xia-2010-2 The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag immunost anti tag immunostaining anti tag immunost Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn Cell (0092-8674) 2010 Only protein-protein interactions imex curation xia-2010-1 The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn Cell (0092-8674) 2010 Only protein-protein interactions imex curation xia-2010-3 The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. drome-ovary Drosophila melanogaster ovary ovary Ovary anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn Cell (0092-8674) 2010 Only protein-protein interactions imex curation xia-2010-4 The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag immunost anti tag immunostaining anti tag immunost Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn Cell (0092-8674) 2010 Only protein-protein interactions imex curation q95si0_drome Receptor protein serine/threonine kinase tkv Atkv Atr25D Brk25D Brk25D1 Brk25D2 Dmel\CG14026 Dtfr STK-A TKV TKV1 Tkv dtfr kv l(2)04415 l(2)25Da str tkv1 tkva Dmel_CG14026 CG14026 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAPKSRKKKAHARSLTCYCDGSCPDNVSNGTCETRPGGSCFSAVQQLYDETTGMYEEERTYGCMPPEDNGGFLMCKVAAVPHLHGKNIVCCDKEDFCNRDLYPTYTPKLTTPAPDLPVSSESLHTLAVFGSIIISLSVFMLIVASLCFTYKRREKLRKQPRLINSMCNSQLSPLSQLVEQSSGSGSGLPLLVQRTIAKQIQMVRLVGKGRYGEVWLAKWRDERVAVKTFFTTEEASWFRETEIYQTVLMRHDNILGFIAADIKGNGSWTQMLLITDYHEMGSLHDYLSMSVINPQKLQLLAFSLASGLAHLHDEIFGTPGKPAIAHRDIKSKNILVKRNGQCAIADFGLAVKYNSELDVIHIAQNPRVGTRRYMAPEVLSQQLDPKQFEEFKRADMYSVGLVLWEMTRRCYTPVSGTKTTTCEDYALPYHDVVPSDPTFEDMHAVVCVKGFRPPIPSRWQEDDVLATVSKIMQECWHPNPTVRLTALRVKKTLGRLETDCLIDVPIKIV fused_drome Serine/threonine-protein kinase fused fu CG6551 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNRYAVSSLVGQGSFGCVYKATRKDDSKVVAIKVISKRGRATKELKNLRRECDIQARLKHPHVIEMIESFESKTDLFVVTEFALMDLHRYLSYNGAMGEEPARRVTGHLVSALYYLHSNRILHRDLKPQNVLLDKNMHAKLCDFGLARNMTLGTHVLTSIKGTPLYMAPELLAEQPYDHHADMWSLGCIAYESMAGQPPFCASSILHLVKMIKHEDVKWPSTLTSECRSFLQGLLEKDPGLRISWTQLLCHPFVEGRIFIAETQAEAAKESPFTNPEAKVKSSKQSDPEVGDLDEALAALDFGESRQENLTTSRDSINAIAPSDVEHLETDVEDNMQRVVVPFADLSYRDLSGVRAMPMVHQPVINSHTCFVSGNSNMILNHMNDNFDFQASLRGGGVAAKPIVAPTVRQSRSKDLEKRKLSQNLDNFSVRLGHSVDHEAQRKATEIATQEKHNQENKPPAEAISYANSQPPQQQPQQLKHSMHSTNEEKLSSDNTPPCLLPGWDSCDESQSPPIENDEWLAFLNRSVQELLDGELDSLKQHNLVSIIVAPLRNSKAIPRVLKSVAQLLSLPFVLVDPVLIVDLELIRNVYVDVKLVPNLMYACKLLLSHKQLSDSAASAPLTTGSLSRTLRSIPELTVEELETACSLYELVCHLVHLQQQFLTQFCDAVAILAASDLFLNFLTHDFRQSDSDAASVRLAGCMLALMGCVLRELPENAELVERIVFNPRLNFVSLLQSRHHLLRQRSCQLLRLLARFSLRGVQRIWNGELRFALQQLSEHHSYPALRGEAAQTLDEISHFTFFVT smuf1_drome E3 ubiquitin-protein ligase Smurf1 Smurf HECT-type E3 ubiquitin transferase Smurf1 Lethal with a checkpoint kinase protein SMAD ubiquitination regulatory factor 1 homolog Smurf1 lack CG4943 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNKLDYPRRNGTHKVRITILCARNLARKDLFRLPDPFAKVQVDGTGQVYSTEISKSSLDPKWNAHYDLFLGIGDAITITVWNQRKIHKGSGFLGCVRIPAFNIQSLKGAGFQRLDLGKLSPDDDELVRGQIIISLLSKDGPSSGNPLAIVGPSGDVRGPSEDDSSEDSLPEGWEERRTDNGRVYYVNHATKSTQWDRPRQPGVVGSSHATSPQQRHNTHNGNSGDRQAPAGPTRSTTCTNLMNNGHRSRDLSVTASDERRHSTEILSSVGKENTSPTTPVSATTTPGKKTSSSNSSSAGGRTLEQRPTNEPATPTSSTTSASVRLHSNDNHVKTPKHQTNGHAPPESTPTSPTGQQNYVNGNAQNGSTSGNGSGQAAQPQSASNGWTQEDAATTTSPSTTTSPPRHSQSPPTPNISPPASVTPSANGNVHSPNANSTPAGSGGGSRSYTAATPGQRSQRRSSRQQGEESSTRRRSSRGTRNGGTSGGGGGGGSGQRYASAAIAAANQAARPFLDLPPGYEMRTTQQGQVYFYHIPTGVSTWHDPRIPRDFDTQHLTLDAIGPLPSGWEQRKTASGRVYFVDHNNRTTQFTDPRLSGSILQMIRRGTVPPTSAANAGTPAPPSATPATPSAAAAVPPQATPASNATPTTLTTTTNPPHRIVPDLPQGLLEGADLLPKYRRDLVGKLRALRTELQTMQPQSGHCRLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQYSRDDHYTLQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITLGDIEGVDPDLHRSLTWMLESNISGIIESTFSVENNSFGALVVHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRLKHCTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGFAVE q7pll3_drome eIF4B eIF-4B Dm-eIF4B Dmel\CG10837 EIF-4B Eif4B eIF-4B-L eIF-4B-S eIF-4b eIF4B-L eIF4B-S eIf4b Dmel_CG10837 CG10837 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASAGKKGKKNKGTVISLQSFLCNSDAPVGTTQVSKKIRNLDGDDSDDGSGTLPLVYQLPTAPRANRIFDDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWRRDSQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTPGSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKIADRYSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAARELEIEQRLALARKQDKGRREQGLNEKLAELQVDKNDNESLSATVSWRTNQDYKESDKINKCPGEKQRDEEIHRLNHARGQFNRPELLREKPNANGESKRDCRNDRSVSKKTSQNDLVLQSSNKYSGLDNEGSE q9vg78_drome pps Dmel\CG6525 FBgn0082831 SPP Spp spp Dmel_CG6525 PPS CG6525 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSSVFTEAPSARPAAAEADSNLVVVYSKSGISFDERAIGNIMEEKSISTISVVRITSPTPSMVDQEEDERLEELANFMETATDSELDSDNGSQSGGDNASEMDEHDEENHNTGDDNNSDSTETEADAPRTRKRVGRKPKAIKKRKRRKPKERPQIVGLRVEQFYADNTADMVVKNALKLAGVSVYKRTAETDALMEVIRNDHNYTPFTSPEQLKNHKRDEKMAMEMQAQSRKIIMQAPGSVKLINAKKRVQAIPLSPVQVKVQRLPVKPHQVQQAAQLQPKVQLIRKPIHSPLPRQKPEIIANNSVNARLRPTRAPVKVIAPPVQEYIEDDDDAQSSDSAEEENADKAYDSEEMSEESDEFQESDNDRDSDMDFDMRHSNRRNPNKRKRVRKVVRQTPSKPMKPLPPPPTTPQHFPELKKRKEVLEPKAPQIGQIIQMPATKSVPAVFALGRGLPSTSFLKIRPTHQSLPVKRPPLPTTPANSNVRRMPAVQLGRIVNSPQEVKEIIINKNMASPKGVFTNLNTLLGEDNNAATKSSPVPLRHRAVMSPSTPRSSYNQQMSPIVVPVPAQAHTPSKGFMPIGVDTAQSHKLPAQIVIETHQSSSELAAENDKQLDLINSIVQDELLKSTLVEQPVVNADEDIPKLVKMLESTAADLDPPPVSLPTNIFPAPEMQGVGNAAAADPNNIMDTANEDEITADFLQHVVGLIEEDKQFEAEVVKQVLASTEPGTLDAIVSMPTSIEPVDVPQAHTNLLPNASLTEPAQSMTSLPIACSTPSRSVAASTPPTSAKVVRGYGRVIYLPPIEAPTTRAKRRAQFPSAPGMAATSSSDAGNLSFGESSLDASINQPLNTSSLSNDSQPGSGPKRPNPREPSMARRSTAPRRSKKLDASQNNDPDASESQEDDDDPNKLWCICRQPHNNRFMICCDLCEDWFHGTCVGVTKAMGTDMENKGIDWKCPKCVKRQEERSQPRITDMLVTRPTTQPEQRPSETKVLTTTAEIVQVAAPSAPRRTLPVVLTVASSPMRIPMAKPAKKFPTGAISHQQQQQLNFIRLGPSPGKRISETLCVVCKRPASTSSVYCGEECIRKYAQSAIQAHAATKGPLPQNAGAQSLLNNSFDAKKNKKKDLFEDVLRQADTVSKVERINVFERKSGRVITGHMAPSAHQFRKWLQENPSFEVLPSGTVQSADAEKRLLKGAPEAATSTSEPAVLGVAKKPPEGPAKLSHPQNTTVQASHQLGISSVRPLAKKDKEKTTPTVQAPTPNRIAAGKPEPVRIGIRRSLREQLLARIKEAQAAEENSGQPTTQWPTVLEVDQFVKNVELEMFNSFGRDVGAKYKAKYRSLMFNIKDRKNRTLFEKICAKQVEPRQLVRMTPEQLASQELAKWREEENRHQLDMIKKSELDLLACAQNYVVKTHKGEEVIATKVDVTLPEENVSEASSMADTKQTSLVSEPSTSTLERSTSREKAGSSKEKRHKSHKHHHRKRSRSRSNSRGRSVDKRHRRQHNEGGEQPGSGEREHRSREKQSRERDEIVPSPLPKKRDENDQSPVPKKTAEKKTEASAYNLVDQILESEKTVEQAANLGKPKPSPKPLPTLPSSLKAPEPMDNYSRYLHGLTTSSLWSGTLKMIDLADFEIVMYPVQGNCHQLGNLMPSQMDVIGRITRVNVWEYIKKLKKSPTKEVVIVNIFPASPSETYKFDLFFEYLDSRQRLGVLGVDSDQIRDFYIFPLGSGDKLPPALQTAEPVPFYEEAQRPNTLLGIIVRCLSKRPADAVPSTPSVPTPVPALSSKVAKRSRSSISYPAQSSPKRKISTHSTSSKDDEFDIDAIIKAPIAKLQKTAPKVVPQPSVPNDADEPYSPGGSDDELVPSAPQRPNDLERQVNEINKQIAAQQMEIAGLLKVEPTGSASSSNVLAAISIPANLSKILASIKDKTNLPSSADDGDEEYNPEDDITATSSFASKKPRSKGRLAHLSEAELLSMVPDNLAGVIPRSSRTRHQLAQSPLTPTPLPPPPPPPGV fu-tkv Interaction between tkv and fu 1012286 n/a 1012290 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012291 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs. 2B, 2G tkv-fu-3 Interaction between tkv and fu 1012286 n/a 1012291 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain greater-than greater-than false n/a 1012290 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false kinase region required to bind necessary binding region required to bind deletion analysis deletion analysis range range certain certain sequence position certain false physical association physical association false false false Figs. 2C, 2F, Supp. Fig. 2C Domain mapping of Tkv showed that the fragment lacking extracellular and transmembrane regions exhibited the strongest binding activity to Fu , although all of the truncation mutants of Tkv interacted with Fu. Exact coordinates of deletion mutants are not supplied in the publication tkv-smurf-1 Interaction between tkv and smurf 1012286 n/a 1012290 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012292 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 4A smurf-tkv Interaction between tkv and smurf 1012286 n/a 1012292 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012290 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 4B smurf-fu-1 Interaction between smurf and fu 1012286 n/a 1012292 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hect region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false n/a 1012291 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs. 4A, 4F fu-smurf Interaction between smurf and fu 1012286 n/a 1012292 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012291 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs. 4B Both the N and C terminus of Fu could coimmunoprecipitate with Smurf. fu-lack Interaction between smurf and fu 1012286 n/a 1012291 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012292 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs. 4G Both the N and C terminus of Fu could coimmunoprecipitate with Smurf. tkv-fu-1 Interactors of tkv 1012287 n/a 1012293 unspecified role unspecified role prey prey n/a 1012294 unspecified role unspecified role prey prey n/a 1012291 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 1012290 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false alpha-tubulin and actin were also identified but could not be assigned to a single gene product. Fig. 2A fu-smurf Interaction between smurf and fu 1012288 n/a 1012291 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012292 unspecified role unspecified role prey prey physical association physical association false false false Figs. 4C fu-smurf Interaction between smurf, tkv and fu 1012289 n/a 1012290 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012292 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1012291 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5B