MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tonthat-2011-1 Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tonthatn-2011-1 Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tonthatn-2011-2 Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation slma_ecoli Nucleoid occlusion factor SlmA Protein Ttk slmA ttk yicB Synthetically lethal with a defective Min system protein A b3641 JW5641 protein protein ecoli Escherichia coli (strain K12) MAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ mint ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD slma-1 1016759 slma_ecoli slmA 1016762 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint f1a f1b f1d st1 sf1a sf3 slma-1 1016760 slma_ecoli slmA 1016762 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f1c mint ftsz-slma 1016761 slma_ecoli slmA 1016762 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ftsz_ecoli ftsZ 1016763 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint sf9c