IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sabri-2011-1 Genome annotation and intraviral interactome for the Streptococcus pneumoniae virulent phage Dp-1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Sabri M., Hauser R., Ouellette M., Liu J., Dehbi M., Moeck G., Garcia E., Titz B., Uetz P., Moineau S. 3-AT score of more than 10 was considered to be high confidence data. Only the high confidence interactions have been included in this entry. The medium and low confidence interactions were excluded since IMEx exchange can only be done with high confidence data. peter@uetz.us J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation e7dn74_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MSIKFKTEELSKIVSQLNKLKPSKLLEITNYWHIFGDGECVMFTAYDGSNFLRCIIDSDVEIDVIVKAEQFGKLVEKTTAATVTLVPEESSLKVIGNGEYNIDIVTEDEEYPTFDHLLEDVSEENALTLKSSLFYGIANINDSAVSKSGADGIYTGFLLKGGKAITTDIIRVCINPIKEKGLEMLIPYNLMSILASIPDEKMYFWQIDDTTVYISSASVEIYGKLMEGMEDYEDVSQLDSIEFEDDAAIPTAEILSVLDRLVLFTSAFDKGTVEFLFLKDRLRIKTSTSSYEDIMYASAGKKVSKKEFTCHLNSLLLKEIVSTVTEENFTVSYGSETAIKISSNGVVYFLALQEPEE e7dn79_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MKLEQLMKDWNKDSKALVAVQGLEREALPRIPFSAPSMNYQTYGGLPRKRVVEFFGPESSGKTTSALDIVKNAQMVFEQEWEQKTEELKEKLENARASKASKTAVKELEMQLDSLQEPLKIVYLDLENTLDTEWAKKIGVDVDNIWIVRPEMNSAEEILQYVLDIFETGEVGLVVLDSLPYMVSQNLIDEELTKKAYAGISAPLTEFSRKVTPLLTRYNAIFLGINQIREDMNSQYNAYSTPGGKMWKHACAVRLKFRKGDYLDENGASLTRTARNPAGNVVESFVEKTKAFKPDRKLVSYTLSYHDGIQIENDLVDVAVEFGVIQKAGAWFSIVDLETGEIMTDEDEEPLKFQGKANLVRRFKEDDYLFDMVMTAVHEIITREEG e7dn80_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MRHGDDCGSRNYHSRRRLMQKSLFGPKLVPASSRRKKRTVPKPKPKIDEQVVELMNRRERQVLVHSCIYYYFNDSIIADGQYDKWSHELYSLIVSHPDEFRQTVLYNEFKQFDGNTGMGLPYDCQFAVRVAERLLRK e7dnd5_bpdp1 DNA-directed DNA polymerase protein protein bpdp1 Pneumococcus phage Dp-1 MAQKGLFGAKPRSSKKNDAQLLAQRKNRKPAVEVTYISGNALKDAVARARTLSTRILGHVLDRLELITEEAKLEQYVDKMIEDGIGSIDVETDGLDTIHDELAGVCLYSPSQKGIYAPVNHVSNMTKMRIKNQISPEFMKKMLQRIVDSGIPVIYHNSKFDMKSIYWRLGVKMNEPAWDTYLAAMLLNENESHSLKSLHSKYVRNEENAEVAKFNDLFKGIPFSLIPPDVAYMYAAYDPLQTFELYEFQEQYLTPGTEQCEEYNLEKVSWVLHNIEMPLIKVLFDMEVYGVDLDQDKLAEIREQFTANMNEAEQEFQQLVSEWQPEIEELRQTNFQSYQKLEMDARGRVTVSISSPTQLAILFYDIMGLKSPERDKPRGTGESIVEHFDNDISKALLKYRKYAKLVSTYTTLDQHLAKPDNRIHTTFKQYGAKTGRMSSENPNLQNIPSRGEGAVVRQIFAASEGHYIIGSDYSQQEPRSLAELSGDESMRHAYEQNLDLYSVIGSKLYGVPYEECLEFYPDGTTNKEGKLRRNSVKSVLLGLMYGRGANSIAEQMNVSVKEANKVIEDFFTEFPKVADYIIFVQQQAQDLGYVQTATGRRRRLPDMSLPEYEFEYIDASKNEDFDPFNFDADQQMDDTVPEHIIEKYWAQLDRAWGFKKKQEIKDQAKAEGILIKDNGGKIADAQRQCLNSVIQGTAADMTKYAMIKVHNDAELKELGFHLMIPVHDELLGEVPIKNAKRGAERLTEVMIEAAKDIISLPMKCDPSIVERWYGEEIEI e7dnd2_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MLMKVNGLQIEATPEQIIEKLSRQLEDEGTFIFRRTKSLGSNYQFSCPFHAGGTEKHPSCGMSRNPSYSGSKVTEAGTVHCFTCGYTSGLTEFVSNVLGRNDGGFYGNQWLKRNFGTSSEVVRQGVSPEAFRRNGRTEKVEHKIIPEEELDKYRFIHPYMYERKLTDELIEMFDVGYDKLHDCITFPVRNLKGETVFFNRRSVRSKFHQYGEDDPKTEFLYGQYELVAFRDYFEKPISQVFVTESVINCLTLWSMKIPAVALMGVGGGNQINLLKRLPYRNIVLALDPDNAGQTAQEKLYRQLKRSKVVRFLNYPKEFYDNKWDINDHPELLNFNDLVL hypothetical protein protein protein bpdp1 Pneumococcus phage Dp-1 Similar to C4Z5Z0 hypothetical protein/signal peptide/glnq partial protein protein bpdp1 Pneumococcus phage Dp-1 e7dn81_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MNLASKYRPQTFEEVVAQEYVKEILLNQLQNGAIKHGYLFCGGAGTGKTTTARIFAKDVNKGLGSPIEIDAASNNGVENVRNIIEDSRYKSMDSEFKVYIIDEVHMLSTGAFNALLKTLEEPSSGTVFILCTTDPQKIPDTILSRVQRFDFTRIDNDDIVNQLQFIIESENEEGAGYSYERDALSFIGKLANGGMRDSITRLEKVLDYSHHVDMEAVSNALGVPDYETFASLVEAIANYDGSKCLEIVNDFHYSGKDLKLVTRNFTDFLLEVCKYWLVRDISITQLPAHFESKLEQFCEAFQYPTLLWMLEEMNELAGVVKWEPNAKPIIETKLLLMSKEE e7dn82_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MIGQGLVKSTISKWKQLPKYIIVEGEVGSGRKTLIRYIASKFDADSIVVGTSVDDIRNIIQDAQTIFKARIYVIDGNSLSMSALNSLLKIAEEPPLNCHIAMTVDSINNALPTLASRAKVLTMLPYTNEEKMQFVKSYKKVDTSGIDDRAIVDYCNLASNLQMLEDILEYGAEELFEKVTTFYDLIWEASASNSLKVTNWLKFKETDEGKIEPKLFLNCLLNWSTVVIRKHYVEMSFEELEAHDLLVREASRCLRKVSKKGSNARVCVNEFIRRVKQVE e7dn65_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MSQNTTRTDAELTGVTLLGNQDTKYDYDYNPDVLETFPNKHPENNYLVTFDGYEFTSLCPKTGQPDFANVFISYIPNEKMVESKSLKLYLFSFRNHGDFHEDCMNIILNDLYELMEPKYIEVMGLFTPRGGISIYPFVNKVNPQFATPELEQLQLQRKLNFLGNVQGLGRAIR e7dn66_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MKSVVLLSGGVDSATCLAIEVDKWGSKNVHAIAFNYGQKHEAELENAANVAMFYGVKFTILEIDSKIYSSSSSSLLQGKGEISHGKSYAEILAEKEVVDTYVPFRNGLMLSQAAAYAYSVGASYVVYGAHADDAAGGAYPDCTPEFYNSMSNAMEYGTGGKVTLVAPLLTLTKAQVVKWGIDLDVPYFLTRSCYESDAESCGTCATCIDRKKAFEENGMTDPIHYKEN hypothetic protein /signal peptide/rholike domain /lipoprotein anchor protein protein bpdp1 Pneumococcus phage Dp-1 e7dna1_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MTISLRNKLPKFNFVPFSKKQLQLLTWWTKGSPFRTFDIVIADGSIRSGKTVSMALSFSLWAMTEFNGQNFAICGKTIHSARRNVIQPLKQMLTSRGYEIRDVRNENLLIIRHFRNGEEIVNYFYIFGGKDESSQDLIQGVTLAGIFCDEVALMPESFVNQATGRCSVTGSKMWFSCNPANPNHYFKKNWIDKQVEKRILYLHFTMDDNPSLTDSIKRRYEKMYAGVFRKRFILGLWVTADGLVYSMFNEEQHVKKLNIEFDRLFVAGDFGIYNATTFGLYGFSKRHKRYHLIESYYHSGREAEEQLTEADVNSNIQFSSVLQKTTKEYANDLVDMIRGKQIEYIILDPSASAMIVELQKHPYIARKNIPIIPARNDVTLGISFHAELLAENRFTLDPSNTHDIDEYYAYSWDSKASQTGEDRVIKEHDHCMDRNRYACLTDALINDDFGFEIQILSGKGARN hypothetical protein/znfinger domain protein protein bpdp1 Pneumococcus phage Dp-1 Similar to YP_002863284 e7dn68_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MVNQYNQPERGKIRINVRDPEKMPIMEIFGPTIQGEGMVIGQKTIFIRTGGCDYHCNWCDSAFTWNGTTEPEYITGKEAASRILKLAFNDKGEQICNHVTLTGGNPALINEPMAKMISILKEHGFKFGLETQGTRFQEWFKEVSDITISPKPPSSGMRTNMKILEAIVDRMNDENLDWSFKIVIFDENDLAYARDMFKTFEGKLRPVNYLSVGNANAYEEGKISDRLLEKLGWLWDKVYEDPAFNNVRPLPQLHTLVYDNKRGV e7dn67_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MRVSKTLTFDAAHQLVGHFGKCANLHGHTYKVEISLAGGTYDHGSSQGMVVDFYHVKKIAGTFIDRLDHAVLLQGNEPIALANAVDTKRVLFGFRTTAENMSRFLTWTLTELMWKHARIDSIKLWETPTGCAECTYYEIFTEDEIEMFKNVTFIDKDEKITVREILEQEQDNG e7dna7_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MNIYDYINAGEIASYIQALPSNALQYLGPTLFPNAQQTGTDISWLKGANNLPVTIQPSNYDAKASLRERAGFSKQATEMAFFRESMRLGEKDRQNLQMLLNQSSALAQPLITQLYNDTKNLVDGVEAQAEYMRMQLLQYGKFTVKSTNSEAQYTYDYNMDAKQQYAVTKKWTNPAESDPIADILAAMDDIENRTGVRPTRMVLNRNTYNQMTKSDSIKKALAIGVQGSWENFLLLASDAEKFIAEKTGLQIAVYSKKIAQFADADKLPDVGNIRQFNLIDDGKVVLLPPDAVGHTWYGTTPEAFDLASGGTDAQVQVLSGGPTVTTYLEKHPVNIATVVSAVMIPSFEGIDYVGVLTTN e7dna5_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MAYQLEDLLKGLDEPTIKQVKEIISKTSKELDAKIFIDGDGQHFVPHARFDEVVQQRDAANGSINSYKEQVATLSKQVKDNGDAQTTIQNLQEQLDKQSQLAKGAVITSALHPLISDSIAPAADILGFMNLDNITVESDGKVKGLDEELKAVRESRKYLFKEVEVPAEQEAQAKSPAGTGNLGNPGRVGGGVPEPREIGSFGKQLAAAQQTAGAQEQSSFFK e7dnd3_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MKEANRLVSSYVGFECWTDEECIRNFELDPDMSIASAYHRYFGMLYSYAKRFKCLSRHDIESIAFETISKCLATFKSNQGAKFSTYLTRLFKNRIVLEYRYLNAPSMNRNWYVEVTFDSVSTNEEGDDFSILSTVGYCEDYGKIEIEASLDFMTLSNTEYAYISSVIQNGPSVSDAEIAREIGVSRSAISQSKKSLKNKLKDFI structural listeria bacteroides repeat domain protein Hypothetical protein/Zn-finger domain. protein protein bpdp1 Pneumococcus phage Dp-1 Similar to NP_781743 e7dnb8_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MIDNNLPMSPIPGEIVQVYDQNFNLIGASDEIFSKHYEDEIVTRARGKETFTFESIETSSIYQHLKVENIIQYGGRWFRIKYAQDVEDVKGLTKFTCYALWYELAEGLPRKLKHVASSVGAVALDIIKDAGEWVRLVCPPDGANKQVRSITAAENSMLWHLRYLAKQYNLELTFGYEEIIKQEVRIVQTVVFLQPYVESKVDFPLVVEENLKYVTRQEDSRNLCTAYKLTGKKEEGSQEPLTFASINNGSEYLIDVSWFTTRHMKPRYIAKSKSDEHFRIKENLMSAARAYLDIYSRPLIGYEASAVLYNKVPDLHHTQLIVDDHYDVIEWRKISARKIDYDDLSNSTIIFQDPRKDLMDLLNEDGEGVLSGETVNESQVVIRYADDILGTNFNAESGKYIGVLNTNKKPSELVPDDFTWIRLEGPKGDAGLPGAPGRDGVDGVPGKSGVGIADTAITYAVSVSGTQEPENGWSEQVPELIKGRFLWTKTFWRYTDGSHETGYSVAYIGQDGNSGKDGIAGKDGVGIAATEVMYASSPSATEAPAGGWSTQVPTVPGGQYLWTRTRWRYTDQTDEIGYSVSRMGEQGPKGDAGRDGIAGKNGIGLKSTSVSYGISPTDSAIPGVWASQVPSLIKGQYLWTRTIWTYTDSTTETGYQKTYIPKDGNDGKNGIAGKDGVGIKSTTITYAGSTSGTVAPTSNWTSAIPNVQPGFFLWTKTVWNYTDDTSETGYSVSKIGETGPRGVQGLQGPQGLQGIPGPAGADGRSQYTHLAFSNSPNGEGFSHTDSGRAYVGQYQDFNPVHSKDPAAYTWTKWKGNDGAQGIPGKPGADGKTNYFHIAYASSADGSREFSLEDNNQQYMGYYSDYEQADSRDRTKYRWFDRLANVQVGGRNEFLNSLFEFGLKPRYSSYNLMDGQDQTQGQISATIDERQRFKGANSLRLDSTWNGKPQNQKLTFSLGGDTRLGTPTEWSNLEGRISFWAKASRNGVSLAARPGYRSNVFTATLTDQWKFYDFKFFDKVNSNCTAEAIFHVFTQSCSVWLNHIKIELGNISTPFSEAEEDLKYRIDSKADQKLTNQQLTALTEKAQLHDAELKAKATMEQLSNLEKAYEGRMKANEEAIKKSEADLILAASRIEATIQELGGLRELKKFVDSYMSSSNEGLIIGKNDGSSTIKVSSDRISMFSAGNEVMYLTQGFIHIDNGIFTQSIQVGRFRTEQYSFNPDMNVIRYVG e7dnb9_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MTKFINSYGPLHLNLYVEQVSQDVTNNSSRVSWRATVDRDGAYRTWTYGNISNLSVWLNGSSVHSSHPDYDTSGEEVTLASGEVTVPHNSDGTKTMSVWASFDPNNGVHGNITISTNYTLDSIPRSTQISSFEGNRNLGSLHTVIFNRKVNSFTHQVWYRVFGSDWIDLGKNHTTSVSFTPSLDLARYLPKSSSGTMDICIRTYNGTTQIGSDVYSNGWRFNIPDSVRPTFSGISLVDTTSAVRQILTGNNFLQIMSNIQVNFNNASGAYGSTIQAFHAELVGKNQAINENGGKLGMMNFNGSATVRAWVTDTRGKQSNVQDVSINVIEYYGPSINFSVQRTRQNPAIIQALRNAKVAPITVGGQQKNIMQITFSVAPLNTTNFTEDRGSASGTFTTISLMTNSSANLAGNYGPDKSYIVKAKIQDRFTSTEFSATVATESVVLNYDKDGRLGVGKVVEQGKAGSIDAAGDIYAGGRQVQQFQLTDNNGALNRGQYNDVWNKRETEFTWRSNKYEDNPTGTRGEWGLFQNFWLDSWKMVQSFITMSGRMFIRTANDGNSWRPNKWKEVLFKQDFEQNNWQKLVLQSGWNHHSTYGDAFYSKTLDGIVYLRGNVHKGLIDKEATIAVLPEGFRPKVSMYLQALNNSYGNAILCIYTDGRLVVKSNVDNSWLNLDNVSFRI e7dnc3_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MGVDIEKGVAWMQARKGRVSYSMDFRDGPDSYDCSSSMYYALRSAGASSAGWAVNTEYMHAWLIENGYELISENAPWDAKRGDIFIWGRKGASAGAGGHTGMFIDSDNIIHCNYAYDGISVNDHDERWYYAGQPYYYVYRLTNANAQPAEKKLGWQKDATGFWYARANGTYPKDEFEYIEENKSWFYFDDQGYMLAEKWLKHTDGNWYWFDRDGYMATSWKRIGESWYYFNRDGSMVTGWIKYYDNWYYCDATNGDMKSNAFIRYNDGWYLLLPDGRLADKPQFTVEPDGLITAKV s layer protein membranar peptidase (hypothetical protein) protein protein bpdp1 Pneumococcus phage Dp-1 e7dn74-e7dn79 1160519 e7dn74_bpdp1 DNA polymerase III subunit �-clamp/ DnaN 1160520 unspecified role unspecified role bait bait e7dn79_bpdp1 RecA/Ploop NTPase 1160521 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dn74-e7dn80 1160519 e7dn74_bpdp1 DNA polymerase III subunit �-clamp/ DnaN 1160520 unspecified role unspecified role bait bait e7dn80_bpdp1 NAD-dependent DNA ligase 1160522 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dn80-e7dn74 1160519 e7dn74_bpdp1 DNA polymerase III subunit �-clamp/ DnaN 1160520 unspecified role unspecified role prey prey e7dn80_bpdp1 NAD-dependent DNA ligase 1160522 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dn74-e7dnd5 1160519 e7dnd5_bpdp1 DNA polymerase I/ DnaQ-like superfamily in N-terminus/ DnaA-polymmerase/ 3'-5' exonuclease 1160523 unspecified role unspecified role prey prey e7dn74_bpdp1 DNA polymerase III subunit �-clamp/ DnaN 1160520 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dnd5-e7dn74 1160519 e7dnd5_bpdp1 DNA polymerase I/ DnaQ-like superfamily in N-terminus/ DnaA-polymmerase/ 3'-5' exonuclease 1160523 unspecified role unspecified role bait bait e7dn74_bpdp1 DNA polymerase III subunit �-clamp/ DnaN 1160520 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dnd2-hypothetical_ 1160519 e7dnd2_bpdp1 DNA primase/ DnaG Toprim domain 1160524 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 47.5 supplemental tables A, D and E 47.5 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 e7dn79-hypothetical_ 1160519 e7dn79_bpdp1 RecA/Ploop NTPase 1160521 unspecified role unspecified role bait bait hypothetical protein/signal peptide/glnq partial Hypothetical protein/signal peptide/glnQ partial 1160526 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dn80-hypothetical_ 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey e7dn80_bpdp1 NAD-dependent DNA ligase 1160522 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dn81-e7dn81 1160519 e7dn81_bpdp1 "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 1160527 unspecified role unspecified role prey prey e7dn81_bpdp1 "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 1160527 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 49.75 supplemental tables A, D and E 49.75 e7dn81-e7dn82 1160519 e7dn82_bpdp1 DNA polymerase III gamma /tau subunit 1160528 unspecified role unspecified role prey prey e7dn81_bpdp1 "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 1160527 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 e7dn81-e7dn82 1160519 e7dn81_bpdp1 "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 1160527 unspecified role unspecified role bait bait e7dn82_bpdp1 DNA polymerase III gamma /tau subunit 1160528 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 49.75 supplemental tables A, D and E 49.75 e7dn82-e7dn81 1160519 e7dn81_bpdp1 "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 1160527 unspecified role unspecified role prey prey e7dn82_bpdp1 DNA polymerase III gamma /tau subunit 1160528 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dn65-e7dn65 1160519 e7dn65_bpdp1 Queuosine biosynthesis protein QueF /T-fold domain 1160529 unspecified role unspecified role prey prey e7dn65_bpdp1 Queuosine biosynthesis protein QueF /T-fold domain 1160529 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dnd5-hypothetical_ 1160519 e7dnd5_bpdp1 DNA polymerase I/ DnaQ-like superfamily in N-terminus/ DnaA-polymmerase/ 3'-5' exonuclease 1160523 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 hypothetic-hypotheti 1160519 hypothetical protein/signal peptide/glnq partial Hypothetical protein/signal peptide/glnQ partial 1160526 unspecified role unspecified role prey prey hypothetical protein/signal peptide/glnq partial Hypothetical protein/signal peptide/glnQ partial 1160526 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 24 supplemental tables A, D and E 24 e7dn66-e7dn66 1160519 e7dn66_bpdp1 Queuosine biosynthesis protein QueC /ExsB domain 1160530 unspecified role unspecified role bait bait e7dn66_bpdp1 Queuosine biosynthesis protein QueC /ExsB domain 1160530 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 47.5 supplemental tables A, D and E 47.5 e7dn66-hypothetical_ 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey e7dn66_bpdp1 Queuosine biosynthesis protein QueC /ExsB domain 1160530 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 47.5 supplemental tables A, D and E 47.5 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 e7dnd5-hypothetical_ 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey e7dnd5_bpdp1 DNA polymerase I/ DnaQ-like superfamily in N-terminus/ DnaA-polymmerase/ 3'-5' exonuclease 1160523 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 hypothetic-hypotheti 1160519 hypothetic protein /signal peptide/rholike domain /lipoprotein anchor Hypothetic protein /Signal peptide/Rho-like domain /lipoprotein anchor 1160531 unspecified role unspecified role prey prey hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 49 supplemental tables A, D and E 49 e7dna1-hypothetical_ 1160519 e7dna1_bpdp1 "Terminase, large subunit/ Terminase 3 superfamily" 1160532 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey hypothetical protein/znfinger domain Hypothetical protein/Zn-finger domain 1160533 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 e7dn68-e7dn67 1160519 e7dn68_bpdp1 Queuosine biosynthesis protein QueE/Radical-SAM 1160534 unspecified role unspecified role bait bait e7dn67_bpdp1 Queuosine biosynthesis protein QueD /T-fold domain 1160535 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dna7-e7dna5 1160519 e7dna7_bpdp1 Major capsid protein/ Phage_cap_E superfamily 1160536 unspecified role unspecified role bait bait e7dna5_bpdp1 Minor capsid protein/ Phage_GP20 1160537 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dna7-e7dna5 1160519 e7dna7_bpdp1 Major capsid protein/ Phage_cap_E superfamily 1160536 unspecified role unspecified role bait bait e7dna5_bpdp1 Minor capsid protein/ Phage_GP20 1160537 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 e7dna7-hypothetic_pr 1160519 e7dna7_bpdp1 Major capsid protein/ Phage_cap_E superfamily 1160536 unspecified role unspecified role bait bait hypothetic protein /signal peptide/rholike domain /lipoprotein anchor Hypothetic protein /Signal peptide/Rho-like domain /lipoprotein anchor 1160531 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 e7dna7-hypothetic_pr 1160519 hypothetic protein /signal peptide/rholike domain /lipoprotein anchor Hypothetic protein /Signal peptide/Rho-like domain /lipoprotein anchor 1160531 unspecified role unspecified role prey prey e7dna7_bpdp1 Major capsid protein/ Phage_cap_E superfamily 1160536 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 hypothetical_-e7dnd3 1160519 e7dnd3_bpdp1 RNA polymerase sigma factor/Sigma_70_r2/Sigma70-ECF 1160538 unspecified role unspecified role prey prey hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 24.75 supplemental tables A, D and E 24.75 e7dn68-e7dn68 1160519 e7dn68_bpdp1 Queuosine biosynthesis protein QueE/Radical-SAM 1160534 unspecified role unspecified role prey prey e7dn68_bpdp1 Queuosine biosynthesis protein QueE/Radical-SAM 1160534 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 structural_li-e7dnd3 1160519 e7dnd3_bpdp1 RNA polymerase sigma factor/Sigma_70_r2/Sigma70-ECF 1160538 unspecified role unspecified role prey prey structural listeria bacteroides repeat domain protein Structural Listeria Bacteroides repeat domain protein 1160539 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 24.75 supplemental tables A, D and E 24.75 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 e7dnb8-e7dnb9 1160519 e7dnb8_bpdp1 Antireceptor/ put_anti_recept TIGR1665 in N-terminus /DUF1142 in the middle /collagene binding repeats in the middle 1160540 unspecified role unspecified role bait bait e7dnb9_bpdp1 Minor structural protein/DUF859 1160541 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 49 supplemental tables A, D and E 49 e7dnb9-e7dnb9 1160519 e7dnb9_bpdp1 Minor structural protein/DUF859 1160541 unspecified role unspecified role prey prey e7dnb9_bpdp1 Minor structural protein/DUF859 1160541 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 24 supplemental tables A, D and E 24 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 hypothetic-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 e7dnc3-e7dnc3 1160519 e7dnc3_bpdp1 Endolysin/N-terminus Amidase 5/ middle to C-terminus glucan-binding domain/ C-terminus CW_binding_1 1160542 unspecified role unspecified role bait bait e7dnc3_bpdp1 Endolysin/N-terminus Amidase 5/ middle to C-terminus glucan-binding domain/ C-terminus CW_binding_1 1160542 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50 s_layer_pr-hypotheti 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role prey prey s layer protein membranar peptidase (hypothetical protein) S -layer protein membranar peptidase (Hypothetical protein) 1160543 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 e7dnd2-e7dnd2 1160519 e7dnd2_bpdp1 DNA primase/ DnaG Toprim domain 1160524 unspecified role unspecified role bait bait e7dnd2_bpdp1 DNA primase/ DnaG Toprim domain 1160524 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 25 supplemental tables A, D and E 25 hypothetical_-e7dnd3 1160519 hypothetical protein Hypothetical protein 1160525 unspecified role unspecified role bait bait e7dnd3_bpdp1 RNA polymerase sigma factor/Sigma_70_r2/Sigma70-ECF 1160538 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 supplemental tables A, D and E 50