InnateDB InnateDB nold-2010-1 IL-37 is a fundamental inhibitor of innate immunity. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Nold MF., Nold-Petry CA., Zepp JA., Palmer BE., Bufler P., Dinarello CA. cdinarello@mac.com Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity nold-2010-2 IL-37 is a fundamental inhibitor of innate immunity. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nold MF., Nold-Petry CA., Zepp JA., Palmer BE., Bufler P., Dinarello CA. cdinarello@mac.com Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity il37_human Interleukin-37 Interleukin-1 family member 7 IL37 Interleukin-23 IL1F7 FIL1Z IL1H4 IL1RP1 FIL1 zeta IL-1X Interleukin-1 homolog 4 Interleukin-1 zeta Interleukin-1-related protein protein protein human Homo sapiens Human MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS il1f7-smad3 1131568 n/a 1131570 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131571 unspecified role unspecified role neutral component neutral component region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fig. 4A 10ng/mL IL-1B il1f7-smad3-2 1131569 n/a 1131570 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131571 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4B 10ng/mL IL-1B, interaction peaking at 15-30mins.